CAZyme Information: MGYG000001371_05676

Basic Information

• Species: Paenibacillus lautus_A
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lautus_A
• CAZyme ID: MGYG000001371_05676
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686		76298.32	5.1101

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001371	6950059	Isolate	not provided	not provided

• Gene Location: Start: 135559; End: 137619 Strand: -

Full Sequence      

MLGSSDTAVNVGVNAESHIRLANGLVAIKVDLEKGGYAYAGSKGFALQEVRSGFRWQGRE
YHTGHYDRHYMIGQPEKIQDRFGTGIHAVIKHESDLLPGLEQHFYVYEGASSFITRVVIV
GAEEMKVNRIAVVKTDSVSSGSETVPGEALHVLRVPYDNDKWVRYLTETAPLETESYEVT
ALFQPDSRYGLILGSISHDVWKTGIRVKGETAGKLDELELYAGAADIMTRDSQPHGYVRG
TRVESPLVMVGDYDDYRAGLEAYGEANTKIAPALSWEGGVPIGWNSWSAAMSTLDYDLYV
ATSDFLKREVQPQGFHNENTLYVNFDAFWDRLTPAEMEDALKRVRENGHKPGTYWTPFAF
WGSPAGFGNPVEGTDGKYTYGDILLRDQDGEILPDVDGGLAIDPTHPGNLARIDWFMDKF
VSEGFEYIKLDFMAHGALEGKHHNPDITTGIAAYNYGLSYLTEKLSPERIGRPFFINLSI
APLFPYSYAHSRRISCDVFGTMKDTEYLLNSLTHGWWMNDTLYRFNDPDHAVIYKSFNQD
STTRHEGRSRLTASVISGTVLLLGDDFRHEEAAWRAKTWLGNEAITEIARLGRTFVPVEG
NLGKQAADTFALTHPSEPGTTYMAVFNFDGAESVQKTVSLERCGLEAHATYTVLDVWEGT
AGQAHGTLTVELAPAESKILKLSRNQ

Enzyme Prediction     

No EC number prediction in MGYG000001371_05676.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17801	Melibiase_C	8.29e-09	615	682	10	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
cd14792	GH27	2.19e-08	281	569	2	251	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14791	GH36	1.74e-06	281	575	3	288	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOT11183.1	0.0	1	686	1	686
ACX66631.1	0.0	1	683	1	683
AYB43258.1	0.0	1	686	1	687
AWP26687.1	0.0	1	685	1	685
AVV57527.1	0.0	1	685	1	685

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001371_05676.