CAZyme Information: MGYG000001372_00247

Basic Information

• Species: Paraprevotella xylaniphila
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella xylaniphila
• CAZyme ID: MGYG000001372_00247
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274		31504.6	4.4623

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001372	3789432	Isolate	not provided	not provided

• Gene Location: Start: 15232; End: 16056 Strand: -

Full Sequence      

MKAKKILFITQEMTPYVPDSELAAMGRELPQEIQEKGREIRTFMPKWGNINERRNQLHEV
IRLSGMNLIIDDTDHPLIIKVASIQAARMQVYFIDNDDYFLKRLMALDENGNEYEDNSER
AIFYARGVLETVKKLRWVPDVIHCQGWMSALVPLYVKTAYKEEPSFRDSKIVYSMSSEDL
KQSMGTNFGNCITFRDVNASVLEDFSPEVTYDELNKLAINYSDGLTVPDTDKFQAFAEYA
QSKEIPVLENVSAADADAFADFYDKVWSQGKNED

Enzyme Prediction     

No EC number prediction in MGYG000001372_00247.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	5	226	1.1e-40	0.4449152542372881

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	1.33e-50	6	174	1	164	Starch synthase catalytic domain.
PRK14098	PRK14098	3.17e-43	5	175	7	178	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	1.50e-32	5	174	1	163	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	1.80e-23	5	174	2	152	glycogen synthase GlgA.
COG0297	GlgA	3.98e-23	5	177	2	166	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25341.1	1.12e-124	1	272	1	274
ADY34869.1	1.15e-121	1	267	1	269
QEW37080.1	2.39e-121	1	267	1	269
QUT58393.1	2.39e-121	1	267	1	269
ABR40536.1	2.39e-121	1	267	1	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNG_A	1.89e-07	2	173	38	216	GranuleBound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa],6GNG_B Granule Bound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4SC83	5.64e-39	5	175	7	178	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1
B3EGV0	1.51e-38	5	175	7	178	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
A1BIY8	5.64e-38	5	175	7	178	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1
Q3B6C3	7.83e-38	5	175	7	178	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
B4S584	2.96e-36	5	175	7	178	Glycogen synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) OX=290512 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999490	0.000462	0.000052	0.000002	0.000001	0.000015

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001372_00247.