CAZyme Information: MGYG000001372_00343

Basic Information

• Species: Paraprevotella xylaniphila
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella xylaniphila
• CAZyme ID: MGYG000001372_00343
• CAZy Family: GH88
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	MGYG000001372_8|CGC2	47352.66	7.9831

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001372	3789432	Isolate	not provided	not provided

• Gene Location: Start: 127967; End: 129217 Strand: +

Full Sequence      

MKRINYKIGFVLLLGLCCRPVAAQQRVDVEKDLQYCHRQVARALAGLKKDGGWDYTRMPR
NILAEDLKEGRTEWNCRPATPEEWCGGFWPGVLWYDYEYGGEAYIGRQARNYTASLAYLA
DRDPYDHDLGFLVYCSFGNGMRIAPCASYRDVIVGTANQLAKLFNPRIGTILSWPREVEK
QGWPHNTIMDNMINLEMLFWASRNGGGQNLYDVAVRHAETTMNNHFRKDGSCYHVAVYDT
VSGKLIKGVTHQGYSDRSMWARGQSWAIYGYTMVYRETRDPRFLAFAQKVTDVYLKRLPE
RSDDWVPLWDFDDPSPSAPKDASAACVVASALLELSVYVDAGKGQQYRKAAENMLSSLSR
NYQSGERCVSFLLHSTGHHPAGSEIDASIIYADYYYYEALLRLRRLQQGRPVLGIG

Enzyme Prediction     

No EC number prediction in MGYG000001372_00343.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	81	403	2.3e-115	0.9817629179331308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.52e-06	77	277	22	207	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU95298.1	5.57e-186	1	414	1	406
QMW87215.1	2.61e-184	9	414	7	406
AAO75253.1	2.61e-184	9	414	7	406
BCA49459.1	2.81e-184	9	414	7	406
QUT42781.1	3.71e-184	9	414	7	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	1.61e-84	77	408	66	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	6.05e-50	83	402	67	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	6.19e-50	83	402	68	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	8.65e-50	83	402	68	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	3.30e-49	83	402	68	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	4.86e-76	82	406	75	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8E372	3.39e-49	83	402	68	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	1.73e-48	61	402	43	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	1.38e-47	83	402	69	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q9RC92	9.34e-45	83	405	41	366	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000356	0.991887	0.007173	0.000203	0.000186	0.000170

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001372_00343.