CAZyme Information: MGYG000001372_00366

Basic Information

• Species: Paraprevotella xylaniphila
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella xylaniphila
• CAZyme ID: MGYG000001372_00366
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1025	MGYG000001372_13|CGC1	115832.07	6.7534

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001372	3789432	Isolate	not provided	not provided

• Gene Location: Start: 16832; End: 19909 Strand: +

Full Sequence      

MKSWKNVIGRLWLFLGFLLLSCPVLAAAFVHPGVLHTEERMQQIRGLVKGKSDDAYASYL
LLEKHPCAQSDYKMEGPFDTIARDGKFGYTKSRMERDFSAAYLNALMWRITGDESHARKA
AEVLTAYARTLKRIPDTNDAPLLAGLEGFKIIYALEALKHTWRKMPAEDYEGALRMFTKV
FLPVLETFYERNPYTNGNWGAIVTKTYMAASIHLDDRKMYEKARAFYLDGYDNGTLAHYI
DGETGQLQESGRDQSHCMLGLGAMATVCELAWQQGDDLYSAKDNRLLKGYEYVARYNLGY
DVPFVRWTDITGKYCDWEEVSPKARGRYMYVFDIAYNHYVNRMGLPMPFTGQVLGQIRPE
GYDRDQPGFGTLLFNEKADYRKFVHPGGLHTLADLERMKAMVGEGQHPWAEGWAELQKDP
WAQSTFAARPMANMGDSRQKASIEAHAAYLNAIRWYISGDEAYARCAINICNAWANTVNQ
VPKARQDQGLLGIPIGEFAMAAEVLRVCPLWERTDFERFKEMMVEYLYPVSRDFLRTHGG
GRVDYCWTNWDACNMVALAAIGVLCDRPDIYREGVEYFKHGLGNGSIRNAVPYLHRMEDG
TVLGQWQESGRDQEHAQLGVGFLATFCQIAWNQGDDLFAYDSNRLLAGAEYVARHNQMRG
VPFTYYNNSQGLNNRWPSVNGLGQLEDRPVWEMIYNHYEVLKGVPAPYSKRMAELLRPEY
GSKDHFGYGSLTFSLRPSNYPILPVPAVPTGLRAEASIGQIRLDWEPSAEYFANGYVIQR
SEAGRDDFRDVGVYKEKVTNWFIDSRIEEGKTYEYRVAAVNKAGTSRFSESVRVKAVSVT
GCPSGWTYAEVGHVEEGRVDYAGVQGGTYRLSCRSAAVDALSDNAPYLYRKVAGDFAVSC
RINRMDGNTEECGLMLRAALKGDATVVTMTLGHWGRRFARMGYRKESGGERRFAIGNTYT
WIPAWFKLARVGNVFYAYESTDGVNWFYVHSEEVEMPREIYVGVAGSFGGGKAAGSVVFD
GLSIE

Enzyme Prediction     

No EC number prediction in MGYG000001372_00366.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05426	Alginate_lyase	2.51e-19	445	655	58	267	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
pfam05426	Alginate_lyase	3.53e-16	71	296	17	267	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
cd00063	FN3	1.50e-11	746	835	1	92	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
smart00060	FN3	4.52e-08	746	826	1	83	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
pfam07081	DUF1349	2.00e-06	883	1025	27	167	Protein of unknown function (DUF1349). This family consists of several hypothetical bacterial proteins but contains one sequence from Saccharomyces cerevisiae. Members of this family are typically around 200 residues in length. The function of this family is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXP82777.1	6.77e-218	372	1024	27	676
QUT56879.1	3.60e-154	1	386	1	390
QQY39805.1	1.38e-153	1	386	1	390
ABR37862.1	1.38e-153	1	386	1	390
AXP82778.1	1.07e-146	377	1024	23	675

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004754	0.504358	0.490135	0.000338	0.000209	0.000198

TMHMM  Annotations     

start	end
13	35