CAZyme Information: MGYG000001372_00395

Basic Information

• Species: Paraprevotella xylaniphila
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella xylaniphila
• CAZyme ID: MGYG000001372_00395
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1533		165566.6	4.6219

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001372	3789432	Isolate	not provided	not provided

• Gene Location: Start: 67797; End: 72398 Strand: +

Full Sequence      

MKKKQILFFACCLALGSSTMDLCAQRTMDKLGRGLVATVTQSGSGNFVSWRVLGEEYYDV
AYNLYADGELVAKGLSASNYVHTGGTAETRYTVAPVVKGKEGEQCAPVKRFKEYSFYSLT
GQNTGFLRVPGAEMKGRNGEDLTEDYMFNDAVLADVDGDGMPEIIAKRLYTGTPGVADVA
NTSAYNRIEVYNVKGERLWYIDIGPNMQSGPDEQFDAVAFDWDGDGKAEVLMRGADNMIV
HHPDGTVTEVGNMSHDIRRINNTEYSMPDNEYLLYMEGATGKLYEIGENGEKWMPYPCKR
LEPGETDWTAAWGDGTGHRATKHYFGAPYLDGRHPSIFVGRGCYTRHKFYTFDVDPATHK
LTERWNWVCSVGGPWFGQGYHNFGVADVDMDGRDEIVFGSMIIDDNGKGLSTTGLGHGDA
QHCTDLDPYRFGQEMFACNESSPAMNYRNATTSELYYRLQSTSDDGRALAGKFYKDYPGC
QGASSQSGVISLTADKPLPDVAGWDLNFRIYWDGDLCSEVLNSPGTERQPKIDKPGVGRI
FLGNGAMNNWSKNNACATGDLFGDWREELLVRDGKDLLVYTTNYPTEFRIPTLWHDHQYR
QGMVWETIGYNQPPHLSYFLGELEGITVAPPPLTTEGRTQVANGGSITTAHNGSQMLVFD
NADMSVSVEPGAEPWVAIFNVPSWVQGTASSDCATKDVPIDYDYYTCTVTGSGFSGATRV
VKLGEGTLVLPDVEMTHGGNTDVWNGTLVFNGTMKQSSLWLNRHTSLRSSGTFRSIKADY
GATVYPGGDGQAGTLTTDSVTLGFGSRVVFDLKNDFTSDRLDTKVLTVETKSWKYGPKYL
APVFEFRGEEVQPGRYPIGTAATVKGDFSSILIEGISSQMSARLVLEDGMLYLSLSDVRA
ASDVVWNGLNSNIWDFGQSENFTLAEESDPVFFVTGDRVLFDDTAERKNVSLSGSIEAES
VTVDNSKSYVFNGNGFLAGHTALVKRGSGVLAISNDNTYTGGTRISGGTVSVNMLSNSTR
AYGGLGGVVESADLFVIENGATLRTTETVTQGSPMKMEGKDGGCVENLKDFIVETPVEGT
LLTKKGDGWMKLNMANPSLERLAINGGTVQCVACDRPAQTVEFISGTLYENTGSSYAIHV
PEGGNGTWSLANRSTYTNKITGEGTLTIYCAVEHGNGWFATRTPVAVNLSLFTGTINATA
DMADSYPRFTLNTSSGMPDGTLNITAGVTVQNTGRTFRIGKLAGKGTLGGYASFANDGAT
GVNTWQVGCDDDFAWAGTVTANSKFEKVGSGKMTVSGVWDNTGEVAVKEGTLCLNDRSAE
NAMLGSGELSVEDGAVLCGMGKLGNASVTVERGGRLYSGTREGASSGTLDFSGKRLTVST
GGEVLFNVASKVRCTTLEGISSFSLRGTLKVSVREGLELEAGDEFQLWVANRTALSSACT
LDLDSPGEGLEWDTSALENGILKVKTATGITGVVSGEPVDCVVYTLDGARAGSFTCMPSE
VGEYMERNGFRSGMYMVKMTQGQRTESRKVTID

Enzyme Prediction     

No EC number prediction in MGYG000001372_00395.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	27	622	9.6e-136	0.9759862778730704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	3.92e-139	28	618	1	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam18370	RGI_lyase	8.68e-27	26	109	1	84	Rhamnogalacturonan I lyases beta-sheet domain. This is the beta-sheet domain found in rhamnogalacturonan (RG) lyases, which are responsible for an initial cleavage of the RG type I (RG-I) region of plant cell wall pectin. Polysaccharide lyase family 11 carrying this domain, such as YesW (EC:4.2.2.23) and YesX (EC:4.2.2.24), cleave glycoside bonds between rhamnose and galacturonic acid residues in RG-I through a beta-elimination reaction. Other family members carrying this domain are hemagglutinin A, lysine gingipain (Kgp) and Chitinase C (EC:3.2.1.14).
PRK15319	PRK15319	1.82e-08	958	1396	668	1072	fibronectin-binding autotransporter adhesin ShdA.
TIGR02601	autotrns_rpt	1.25e-07	982	1013	1	32	autotransporter-associated beta strand repeat. This model represent a core 32-residue region of a class of bacterial protein repeat found in one to 30 copies per protein. Most proteins with a copy of this repeat have domains associated with membrane autotransporters (pfam03797, TIGR01414). The repeats occur with a periodicity of 60 to 100 residues. A pattern of sequence conservation is that every second residue is well-conserved across most of the domain. pfam05594 is based on a longer, much more poorly conserved multiple sequence alignment and hits some of the same proteins as this model with some overlap between the hit regions of the two models. It describes these repeats as likely to have a beta-helical structure. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
PRK15319	PRK15319	7.65e-07	977	1412	747	1120	fibronectin-binding autotransporter adhesin ShdA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29439.1	0.0	4	1518	3	1508
QIM09959.1	5.42e-316	24	1519	10	1528
BCS86257.1	1.89e-267	29	904	3	875
BCJ96202.1	3.98e-105	9	632	16	602
ABN51485.1	3.30e-102	26	632	257	814

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z8R_A	1.57e-98	24	632	1	578	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]
2ZUY_A	3.60e-93	25	632	5	599	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]
4CAG_A	9.04e-93	20	622	3	577	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31526	1.01e-97	13	632	24	615	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1
O31527	1.60e-92	25	632	5	599	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000476	0.065945	0.933535	0.000031	0.000033	0.000030

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001372_00395.