CAZyme Information: MGYG000001372_01156

Basic Information

• Species: Paraprevotella xylaniphila
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella xylaniphila
• CAZyme ID: MGYG000001372_01156
• CAZy Family: GH98
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1341		149611.36	4.4631

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001372	3789432	Isolate	not provided	not provided

• Gene Location: Start: 101047; End: 105072 Strand: +

Full Sequence      

MKQFYLKCKRAFLAGVSFVLMVGAGLVEAKADAPLRRPISPERPMLLVHIDTWNYPDPER
IIEMVPEDILPYVVFNISLSASDNVCADGYAVAGSWLKACAQKRAWAMVQCASGGHSRFS
DHDLSVYEDYFRQYPNFLGWNFAEQFWGFGEDGTPSFLERLSLFGDILKICHRYGGYLVV
SFTQAYYSADMLPIAYMKRNPEVNRLLTEHPEHFICCEKYTMQHGFYEIESNCLGAFLGG
YAGNYGIRFDDCGWSPDDGNPATENDGDLYPFVKAAGAIPIMEHVMLTGQTVIDGPELIW
TDVSREVSTSVTPDGYTRRNWDWFPQFVNIQMDEFRKILDGTVRILTREEVIDRTKICLQ
NDVNDGTFDSYLTPATLFDGLYRPDCDRDRMDGNSWLENKWWMKTSGRYPTIPQVYDLLD
DTAKKLQVVKVSEYDTRWPDIAAKVEELNRLFPQEYTGDIYAAHAENTWMTYNPYQYEDQ
TTNGVRTRYISKRRASGVIPFLYNTADSISLDFSPYAMAVMKEYPDSVALYMSNYRLSDD
NNLVEAENVEDTVRIYGATEEPVVKWYDRADHRASEVKQTWEDGVLTLVVGHNGPVELSI
ECKGKATGRLTEWTPARVEVPERPSVYTGTLQYEAEFFDYKNIGACHTNGYYNGYPGYQG
QGFVEMGTNRSASIRDTVRVLRNGTYTISVRYQVPNGSARMYLIVNGKRKSLTMRATNGV
WAETSVEAELEAGENEVELKFVSTPVNVLVDCIKINRANAYVYDFEDDKPGTSATDPAAE
MMTLMGGEAGVVAIEDNQALHAYAAGTDGMGQALLDLFPRDAVDYSVSWHQLEGDAGMLL
RGGYLFRVQGGKVSLVVMEEDEDGTLRVGKTLAEGDKAEGMAYYRATLLDGKLYFDGSVD
GVQWQNMLSAEDATFSCGETRLCWEAAMTVDDIRFHNTGLTMSQTDLEDINMTYGGTNAV
IRSLEISGTDLLGDVKISLAGNAFGLSLDSLGEYTGALVVESNRLTNEQGAVRVFVRLKP
EMAVDDYEDVMTIATSYMEERKVNLKGSVTPANYATYYDFEDDAVSSGASNPPAEGITRG
VGNLCTAGVSNYTDSENRTSKMLRVYTAPSANGTGVLDLERFTRKSTDYSVTWRQVVTSS
GDYKNGVVLRGDTLTIGNANQGYTLGIMAGYYMNVYNHGTVTDFRIYKSTSSKQLNMFNS
ASVSLQAALGKSIWYRASVSGSSKVTLKIEYSTDGETWHLGTSTTDEGGEFQQGATQYVW
GLAASQGNFLIDDISFEGITYDEGVENGIYSAEETTATVEREEFFDLSGRRILPGDSMTG
VIIRRSYLSDGTVKVDKILKR

Enzyme Prediction     

No EC number prediction in MGYG000001372_01156.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH98	34	343	8.4e-90	0.9877675840978594
CBM35	649	754	5.4e-17	0.8991596638655462

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08306	Glyco_hydro_98M	1.97e-94	35	343	7	328	Glycosyl hydrolase family 98. This domain is the putative catalytic domain of glycosyl hydrolase family 98 proteins.
cd04083	CBM35_Lmo2446-like	1.38e-17	632	755	2	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
pfam08307	Glyco_hydro_98C	1.23e-14	348	603	1	270	Glycosyl hydrolase family 98 C-terminal domain. This putative domain is found at the C-terminus of glycosyl hydrolase family 98 proteins. This domain is not expected to form part of the catalytic activity.
cd04086	CBM35_mannanase-like	3.43e-13	633	740	3	105	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
cd02795	CBM6-CBM35-CBM36_like	2.60e-06	632	755	1	124	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ99817.1	0.0	26	1279	27	1300
BAV06735.1	1.40e-208	10	800	9	789
AXY74108.1	1.09e-206	16	776	17	769
ACE84677.1	1.36e-199	35	757	306	1016
QEI20698.1	5.40e-199	35	757	354	1064

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WMF_A	5.71e-13	128	600	134	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in its native form. [Streptococcus pneumoniae TIGR4]
2WMH_A	5.71e-13	128	600	134	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 in complex with the H- disaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]
2WMG_A	3.93e-12	168	594	167	540	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in complex with the LewisY pentasaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]
4D72_A	5.34e-07	347	568	324	515	Crystalstructure of a family 98 glycoside hydrolase catalytic module (Sp3GH98) in complex with the type 2 blood group A-tetrasaccharide (E558A L19 mutant) [Streptococcus pneumoniae SP3-BS71]
4D71_A	5.34e-07	347	568	324	515	Crystalstructure of a family 98 glycoside hydrolase catalytic module (Sp3GH98) in complex with the type 2 blood group A-tetrasaccharide (E558A X02 mutant) [Streptococcus pneumoniae SP3-BS71]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6RUF5	9.97e-06	33	568	218	732	Blood-group-substance endo-1,4-beta-galactosidase OS=Clostridium perfringens OX=1502 GN=eabC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.012910	0.920209	0.047585	0.018212	0.000690	0.000360

TMHMM  Annotations     

start	end
12	29