CAZyme Information: MGYG000001372_02219

Basic Information

• Species: Paraprevotella xylaniphila
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella xylaniphila
• CAZyme ID: MGYG000001372_02219
• CAZy Family: CBM6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
865	MGYG000001372_65|CGC1	97466.53	4.7098

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001372	3789432	Isolate	not provided	not provided

• Gene Location: Start: 36182; End: 38779 Strand: -

Full Sequence      

MKKMILLCVCLAGLNAMGQQRVFKHPGISYTQADIDRMRAMVDVGQEPYYSAFLEFKESR
YTTYRDYERPLPVHEGQPVIWDNPNLWLDEFGQVAFHNAMMWKLTDETSYADKAVAVLNR
YAPVRSIKPYGTNCLDASKATMLIEAAELLRDYEGWKPEDQQGFKDFLVSPGYSTVEDYY
AKYSSSDTLENRVTVYWNIFQGDPGRHGNQGLYGLRTLMAMGIYLDNDTIYERAYRKLLS
LSHRQDDLPYPKGPKIPHGVQSHVNDEYYILYDASKITVGEEKDYGYDDELKYWIWENGQ
CQEASRDQGHIMDGMCNMVDIARTAWNQGDDVFSAYGGRILQGITYAAKYNYGWYNREQM
KNKYWPEEELFEPTVENGQFIRRMARCARWEGLKINPWSEGNQTDWTRGKQFHSPGTMWM
QYKVRMGLPADSLLWVQRAFDVKKAEDGSMPGGLLDYRTVWMAGDGGTFVDGRHVSGLPA
LPGTIRAVDYDFYSLAANGEGLTYHDKGTEKCKLYRTDGTVEIETVGDSYVVTGMEDGEW
MNYSFTVAKDGYYRIWADAEVSVVGGALYAAVDNGTAVGGELPVGQGFQEHELGVLRLRA
GASVLRMTVKGTDNAVRLRSIRVEETARPSEETDYVWNSRDYSTPIGKGEILTDQSDKLL
VSNRYASELVPTFTVVGEPMAYHITSDKLYLAIHGVNLNMVAFQEATYRLPGGMDDETKA
STSGQAATYSVKGCGAGGDEQLFVWQLDSSANRRIEPLLGDCYAEGVEAYTLKGLCFAVN
GESLYKDTRIDDIGFYTLEELMARYGEDLKDTPLTVPRISMECEGSPAVYRIDGTRVPVD
TSGPDWRVALPGGIYVVDGKKLVLP

Enzyme Prediction     

No EC number prediction in MGYG000001372_02219.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04080	CBM6_cellulase-like	1.80e-17	481	611	1	133	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
pfam05426	Alginate_lyase	6.03e-04	87	234	53	193	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT70389.1	1.88e-147	20	628	480	1095
QQA07135.1	7.22e-147	20	628	480	1095
ALJ42773.1	7.22e-147	20	628	480	1095
QMW87197.1	7.22e-147	20	628	480	1095
AAO75234.1	7.22e-147	20	628	480	1095

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000523	0.997457	0.001410	0.000197	0.000181	0.000173

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001372_02219.