CAZyme Information: MGYG000001373_00213

Basic Information

• Species: Faecalimonas sp000209385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Faecalimonas; Faecalimonas sp000209385
• CAZyme ID: MGYG000001373_00213
• CAZy Family: CBM51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1071	MGYG000001373_1|CGC2	122974.13	5.944

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001373	2218229	Isolate	not provided	not provided

• Gene Location: Start: 225387; End: 228602 Strand: -

Full Sequence      

MKKKKLMRLFAGLLVITMLAPNSIVSVYAEEPVQNEIQQNKNTKIQYLSDKQEVEKRVGY
GSFGKDRNTEMKQNGEGLQVKTRGEKVTFPKGIFAHAPSTVIYDVSELKDKYPNFAGYLG
IDSRSGGGNGVIFKISVSDDKNSWEEIYNSGVVTINDAVYVNLSMKGKKYIKLEADSNGE
NSRDHVVYADAGFVTNDYTPSENYNAPIKTVAEYDEELSKINFRDKNAVNNNTQTIYQRE
LVNQAGFYTINKVYEMEDERGNKLYKDAIEYLLKDKEALYYYINGGPKPSQGTYENSLIA
FGKLYNAYKGELDNNSENDLNIRLAVSVASAYANPKTVRFWTENDNPNSGVEEVQKEDPV
RRYATYKKLSEQGNYMDKISTLAKEPSRNMGNAIWSGKQFKELSVPMMRWVVDSRMHEDE
FEWLAQYITQWASEEENKNKNFLDSYMYVHNKQGNWQYTDEKYYSQQKRAEWNKKYKFDD
FKSFDDNAKYGTKDLIRSWIVWEEGGVCGAYAKTYANLAEVAGRPSIVTGQPAHAAALTW
QWVSDGGPDHKGQYEWRIQNNAWSLRETSSEYEDYLLGWGNRRKMGNIDTNRNRASSYTL
LATDVIQDWDAYVMAKKYTLLANSLKDFSAKREVYYRALTESPRYLDATYGMLDMYLNKP
DLTSAELNRFMKETASRYTYYPMVMADLLREIELSGKLTDPVHMAELYMERQRALEEAYT
LRKDTKNLTADDYEKTRQPWYAGDVARAILEKDHSRIASFSFDGDNAGKIVLTKNLTEKG
LKMKYSLDGGKTWKTSDKDVISLTNDELKSITVENDIQVTVEGATEDMYGRLPICVIDIM
EQEAPKNIEANDKEDLLLGDVSNLEYSEDGGNTWKPYEQNGLKNQNRFTGEKKVTVRRGS
HGQYVASKTAEYQFKNADDKNEEKYLQLQYVSMHEFSSQQNEGNQAAKNLIDGQRNTNWH
SKWDVQDKKEYSVKFDKARRISKLEYVPSVGGSNGRWEEVEIYGSNDGKTWTKIGKSGQL
ANDVNAKEIKVDSSKAWQYIKVKGLHSYSHDGNKDKYFSGSMLNFFEDTTK

Enzyme Prediction     

No EC number prediction in MGYG000001373_00213.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM51	46	192	1.1e-24	0.9850746268656716
CBM32	937	1046	3.6e-18	0.8064516129032258

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08305	NPCBM	3.86e-23	47	193	4	135	NPCBM/NEW2 domain. This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins. This domain has also been called the NEW2 domain (Naumoff DG. Phylogenetic analysis of alpha-galactosidases of the GH27 family. Molecular Biology (Engl Transl). (2004)38:388-399.)
smart00776	NPCBM	5.65e-20	47	193	6	144	This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins.
pfam00754	F5_F8_type_C	7.02e-15	937	1052	4	120	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	3.01e-04	937	1012	17	90	Substituted updates: Jan 31, 2002
pfam13285	DUF4073	0.005	840	897	86	139	Domain of unknown function (DUF4073). This family is frequently found at the C-terminus of bacterial proteins carrying the family, Metallophos pfam00149.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMN35280.1	5.79e-181	1	1071	1	991
AQW23377.1	6.79e-179	31	1071	34	991
ATD49073.1	7.80e-179	31	1071	39	996
BCL58565.1	1.38e-147	58	1071	97	1052
QTR94629.1	7.39e-104	47	1068	144	1099

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2V72_A	4.50e-09	937	1031	19	124	Thestructure of the family 32 CBM from C. perfringens NanJ in complex with galactose [Clostridium perfringens]
4LKS_A	5.50e-09	948	1066	41	165	Structureof CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens in complex with galactose [Clostridium perfringens ATCC 13124],4LKS_C Structure of CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens in complex with galactose [Clostridium perfringens ATCC 13124],4LQR_A Structure of CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens ATCC 13124],4P5Y_A Structure of CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens in complex with N-acetylgalactosamine [Clostridium perfringens ATCC 13124]
2KD7_A	6.35e-09	943	1042	26	126	ChainA, Putative chitobiase [Bacteroides thetaiotaomicron VPI-5482]
3GGL_A	7.77e-09	943	1042	36	136	X-RayStructure of the C-terminal domain (277-440) of Putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR324A. [Bacteroides thetaiotaomicron],6OE2_A X-Ray Structure of the C-terminal domain (277-440) of Putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR324A. Re-refinement of 3GGL with correct metal Mn replacing Zn. New metal confirmed with PIXE analysis of original sample. [Bacteroides thetaiotaomicron]
2VMH_A	1.35e-08	47	191	10	148	Thestructure of CBM51 from Clostridium perfringens GH95 [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0TR53	2.09e-06	937	1064	634	764	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	2.09e-06	937	1064	634	764	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000255	0.999064	0.000197	0.000160	0.000155	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001373_00213.