CAZyme Information: MGYG000001374_00524

Basic Information

• Species: Mediterraneibacter torques
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter torques
• CAZyme ID: MGYG000001374_00524
• CAZy Family: GH18
• CAZyme Description: Spore germination protein YaaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385		43721.14	4.6875

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001374	3092406	Isolate	not provided	not provided

• Gene Location: Start: 551547; End: 552704 Strand: -

Full Sequence      

MIYVVEKGDTLSGIAVKFGVPVWKIVYDNQLKDKNQIVPGQALLLLEVDEGQAEESTQPE
LAKGKTIGGYAYPFIDKEILEQSFPALKELLVFSYGFTFEGNLVPPLQDDLWMIETAWRH
GAKPIMVLTPFSEGAFNNQLVKVLTENVEVQERLLEQLTAEVRRRGFAGVNIDFEYVLPE
NKVQYAAFIGKMRELLRPEGYTVSVAVPPKVSNEQRGLLVEGADYRLIGENADYVFLMTY
EWGYTYGPPMAVAPLDKVRQVVEYALSQIPAEKLILGIPNYGYDWQLPYERGVTRAQTIG
NVQAVDLAVENGALIRYAQTAQSPWFTYKKSGMDHVVWFEDVRSIQAKWKLVQELDLAGA
WYWNLMRKFRGNWLMLESPDAGRNT

Enzyme Prediction     

No EC number prediction in MGYG000001374_00524.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	143	365	9.8e-42	0.6891891891891891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	7.16e-117	69	376	6	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	9.88e-94	2	381	51	423	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
smart00636	Glyco_18	2.51e-32	144	365	85	331	Glyco_18 domain.
cd06549	GH18_trifunctional	2.52e-29	109	373	46	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
pfam00704	Glyco_hydro_18	6.14e-29	129	365	77	304	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHB23011.1	2.34e-168	1	377	1	370
QEI30503.1	2.34e-168	1	377	1	370
QRT29403.1	2.34e-168	1	377	1	370
APO31600.1	2.34e-168	1	377	1	370
QNM04685.1	5.57e-151	1	378	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3K_A	8.83e-74	2	377	6	424	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	6.51e-65	2	376	5	421	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
3CZ8_A	1.48e-59	73	361	19	306	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4Q6T_A	2.17e-25	94	384	37	343	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
5JH8_A	1.01e-22	147	359	85	293	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37531	4.01e-77	2	377	3	420	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	4.64e-64	2	376	4	420	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	1.81e-63	2	376	4	420	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
O05495	2.78e-63	2	375	49	411	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	2.57e-28	42	373	14	336	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001374_00524.