CAZyme Information: MGYG000001374_01342

Basic Information

• Species: Mediterraneibacter torques
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter torques
• CAZyme ID: MGYG000001374_01342
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
209		23483.91	9.976

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001374	3092406	Isolate	not provided	not provided

• Gene Location: Start: 484534; End: 485163 Strand: -

Full Sequence      

MEFWIQQDNSGKIQLPVKPSEFTVTVTHRNTVVNVIQLGDINLMGKTGLREITLASFFPA
KDYNFSNNSSRKEPLTYVEKLETWRKSGSPIRVIITGVLNMEATIESFSYGEQDATGDIY
YTLYIKEYKKIKTKKATVTIATVKPSTRATKAPEASSGKTYTVKSGDCLWKIAKQFYGNG
AQYTKIYNANTDKIKNPNLIYPGQVLTIP

Enzyme Prediction     

No EC number prediction in MGYG000001374_01342.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	161	209	2.5e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	8.19e-24	149	209	89	146	LysM domain/BON superfamily protein; Provisional
COG1652	XkdP	1.59e-18	1	209	56	262	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
NF033163	lipo_LipL71	5.95e-16	144	209	389	460	lipoprotein LipL71. Members of this family are lipoprotein LipL71, also known as LruA, as described in Leptospira interrogans but found broadly in the genus Leptospira. Close homologs that are not lipoproteins by sequence are likely defective in their reported coding region.
cd00118	LysM	6.40e-12	159	208	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	1.23e-09	160	208	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM69700.1	2.63e-99	1	209	1	214
QLY79319.1	4.51e-51	1	208	1	201
QPL02050.1	5.07e-50	1	209	1	212
CDS90455.1	5.07e-50	1	209	1	212
CEK40586.1	5.07e-50	1	209	1	212

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FIM_A	1.15e-13	152	209	90	147	Thestructure of Kbp.K from E. coli [Escherichia coli],7PVC_A Chain A, Potassium binding protein Kbp [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54335	2.14e-40	2	209	7	218	Phage-like element PBSX protein XkdP OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdP PE=4 SV=2
P45932	4.25e-37	2	209	7	218	Uncharacterized protein YqbP OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbP PE=4 SV=1
P0ADE6	5.33e-13	152	209	90	147	Potassium binding protein Kbp OS=Escherichia coli (strain K12) OX=83333 GN=kbp PE=1 SV=2
P0ADE7	5.33e-13	152	209	90	147	Potassium binding protein Kbp OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=kbp PE=3 SV=2
Q9RVY3	1.26e-07	154	209	199	252	Uncharacterized protein DR_0888 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) OX=243230 GN=DR_0888 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001374_01342.