CAZyme Information: MGYG000001374_02004

Basic Information

• Species: Mediterraneibacter torques
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter torques
• CAZyme ID: MGYG000001374_02004
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
553		61417.13	7.4478

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001374	3092406	Isolate	not provided	not provided

• Gene Location: Start: 209203; End: 210864 Strand: +

Full Sequence      

MKKGIDISYWQGKVDFSKVSKSVEFVILREGYRRTIDKRFLEYVQGCKGNSIPIHGVYHF
CYATSTVGAEEEAASCIANMRKAGLGKDVIVFFDFEYDTVKKAAEQGITLGKSECIAFTK
AFCSYVESRGYKAGVYTNLDYYQNMYDKETLDKYILWLADYTGNPDVKCTYQQYTSSGKV
PGINGNVDMNYFFGEKQEEEQMGKTAQDVLNVMRSWLGYNEVNGKFRQIIDLYNSVKPLP
RGYAVQYHDEWCDTTVSAAGIKAGCSDLIGRECGCEQHVKIFQSMGIWIENGTIVPKPGD
IILYNWDQSYQPNNGYSDHIGFVESVSNGQITCIEGNKGEAVARRVLSVGNGNIRGYARP
KYSGAGTAPSNPVTPPVSGGDTPNKNVAWYGVVNTGTLNVRTWAGTENPQLKSYPTISQG
TKVGVCDTIRDKDGDAWYYIQIKGDKGEKYGFVAAAYITKQSSSKPNADTTVSDDGVITK
TPQWVGKVVADVLNVRTWAGTNNPLIKSWPRLGYGNLVDVCDVVNAADGSRWYYIRIDGR
IYGFVHSAYIEKV

Enzyme Prediction     

No EC number prediction in MGYG000001374_02004.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	5	183	4e-36	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	9.67e-70	2	193	1	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	4.51e-27	3	192	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06413	GH25_muramidase_1	1.34e-26	3	194	4	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06525	GH25_Lyc-like	3.49e-26	3	192	1	184	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06524	GH25_YegX-like	7.36e-26	3	194	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU22483.1	1.11e-164	2	368	4	370
QJU22680.1	1.09e-154	2	363	5	378
BAK46682.1	1.04e-83	3	368	4	393
QEI31358.1	1.19e-79	196	363	149	316
QHB23853.1	1.19e-79	196	363	149	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HMC_A	4.21e-11	5	196	8	183	Endolysinfrom Bacillus anthracis [Bacillus anthracis]
4JZ5_A	3.49e-09	5	190	26	210	High-resolutionstructure of catalytic domain of endolysin ply40 from bacteriophage P40 of Listeria monocytogenes [Listeria phage P40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X7H0	1.48e-06	4	198	69	260	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
Q8FFY2	4.74e-06	4	198	69	260	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P76421	8.48e-06	4	198	69	260	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001374_02004.