CAZyme Information: MGYG000001375_00387

Basic Information

• Species: Ruminococcus_F champanellensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_F; Ruminococcus_F champanellensis
• CAZyme ID: MGYG000001375_00387
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		39434.92	6.0426

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001375	2513436	Isolate	not provided	not provided

• Gene Location: Start: 439955; End: 441013 Strand: +

Full Sequence      

MNKQNPPCTGAQAAARMHIGWNLGNTLDSFAPDKGLAAETAWFNPPVTRQVLQAVADAGF
DVIRIPVTWSGHFGAAPGYKLEEAWLERVEQVLRWAMELDVYVILDMHHDGSAMPSPHAW
LVPDAAHIEGVLPVFTALWKQLAERFGAYGDKLIFEGMNEPHCGSDWVGNPERYQAVNRL
NDAFVRTVRASGGINQTRKLLLPTYAASPKQAAIGALVLPEDPYLLASVHAYIPTEFCFP
AREVNWAAPRIQWGTPADHAQLTDLFDRLAKRFPERGIPLLLGEFAAVSKPDDAQRLAWA
EYYVREAARRGIRCLWWDDTSGREECMGLLDRNTCQWRYPELVQTLIRAAYA

Enzyme Prediction     

No EC number prediction in MGYG000001375_00387.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	39	319	1.2e-86	0.9855072463768116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.06e-61	34	318	11	267	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.78e-31	17	318	51	358	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL16630.1	3.91e-274	1	352	1	352
CBL17440.1	6.88e-88	3	348	36	374
ADU86903.1	9.59e-86	12	352	81	416
ADL33047.1	1.47e-85	12	352	120	455
AGF55279.1	6.80e-85	9	350	38	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MQ4_A	1.03e-87	9	350	11	349	ChainA, cellulase [Acetivibrio cellulolyticus]
4IM4_A	1.37e-86	19	350	16	335	ChainA, Endoglucanase E [Acetivibrio thermocellus],4IM4_B Chain B, Endoglucanase E [Acetivibrio thermocellus],4IM4_C Chain C, Endoglucanase E [Acetivibrio thermocellus],4IM4_D Chain D, Endoglucanase E [Acetivibrio thermocellus],4IM4_E Chain E, Endoglucanase E [Acetivibrio thermocellus],4IM4_F Chain F, Endoglucanase E [Acetivibrio thermocellus]
6WQP_A	2.44e-83	9	348	15	354	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
3NDY_A	1.50e-79	12	348	14	339	Thestructure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDZ_A The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans]
6PZ7_A	2.82e-77	9	347	8	334	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23660	1.02e-81	12	350	29	363	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P10477	1.05e-80	19	350	66	385	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
P28623	1.60e-77	12	348	45	370	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P28621	1.55e-75	9	352	41	376	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
Q12647	8.86e-73	19	348	34	361	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001375_00387.