CAZyme Information: MGYG000001375_00533

Basic Information

• Species: Ruminococcus_F champanellensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_F; Ruminococcus_F champanellensis
• CAZyme ID: MGYG000001375_00533
• CAZy Family: CBM22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1121		122404.31	4.7077

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001375	2513436	Isolate	not provided	not provided

• Gene Location: Start: 591718; End: 595083 Strand: +

Full Sequence      

MTDSYVTDIRARHKRNIRLAWLLLILGLVVACSVAWTLRGVGITMANETVCGMEEHQHSA
ACYADTADGSQLICTLPEHIHTVACTGIDTANNGPPVVEITTPTEDPTEPATEPERETVQ
LPNYLADASASYEKNVIYVKTALGERSKDTVHEYLANLGLPGTNDGKYILNSEESPYILQ
VGDTVELCIYTDSSNTDGFWSSSSPDGVLVAGTATTTTLADGTKKIEKTYSTAKAGTGVI
YFGNQSSFYVSVPVPKEELKDFHYDHADIEITDGGYYEIKRTVTDQNGNQVTTRQIFDSY
ISGVNHCYIYNAAGSLIKTYESTDYQANGKPGETQYELTSKYKCMEKEEKWFKRSEVDHA
QFDVQLLLKPRKQIVTVTKDGVQSSQTETDISDSTGESDVTILSAVFNMNHRSVVDANNK
CPDHSGLDFNLMANVNQIITVEPASVEPTAHKQLTNGSIGTNQFRFELLDKDGKLIDRQY
CDTTGKVTFESQYFLMPGTYTYTIRESIPSEAVQIDGKPYSRGIFYDSHTEKVTVTVTAD
AQGNLSASMAYAGGSAPVFHNTAVTERYMPISVQKVWSDSSTVNHKADAIGFRIWRTESG
QPDALVSIDGKSKFYLNDASGWKWSYTKLPVQYAGRTYSYRVEEVDIPDGYIAGYTSGQN
GGTLEYTITNTSKDAITLSIQKQWLAPDGTPMQGTPTAQSVSASLQRQCKEVEIPVTIQV
VSPAGALLEQYKQPAYVGSSFTFTLGVTEGTAENVSVVSAEKCSAAYANGVFTVQDIQVG
ARVQVRCDNVMDSTKLLLHHTFEDTQEDWTCTGDAKPGSAYSTNYAATGSGYHALKIYNR
TKAWMGASFTLDSSVIKPGQTYSFSAYLNRAAVYTESDNTTTHNLGADHTAPLNLTLYYE
DSAGVPNYLGIAAVAAASSGSWIHLRNASLTIPADCTVMKLQVDANGEEGTDKFSDLFLD
EVIIAPAGMDISVEQNTGRVLLNNPEFYSFTVTGKTIPADVQQNADNWHLDAWNKQIEIT
AAEGWIKTLSGAELGQVSNRIYQYFVEEDPMTGFTPSYSDMYVSSNTAQTPIIIKNQSIA
YTLPATGGVGLVPFLGGGSLLILASGLYSYKLIRSKRRSSA

Enzyme Prediction     

No EC number prediction in MGYG000001375_00533.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM22	796	941	2.3e-23	0.9465648854961832

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12892	FctA	4.04e-16	448	562	1	111	Spy0128-like isopeptide containing domain. The FCT and equivalent region genes of Streptococcus pyogenes and other related bacteria encode surface proteins that include fibronectin- and collagen-binding proteins and the serological markers known as T antigens. Some of these proteins give rise to pilus-like appendages. The FctA family is found in many Firmicutes and related bacteria. In S. pyogenes, the pili have a role in bacterial adherence and colonisation of human tissues. Members of this family have a conserved N-terminal lysine and C-terminal asparagine that can form a covalent isopeptide bond.
pfam02018	CBM_4_9	1.54e-09	796	935	3	120	Carbohydrate binding domain. This family includes diverse carbohydrate binding domains.
cd00222	CollagenBindB	4.58e-09	571	671	3	91	Repeat unit of collagen-binding protein domain B. The collagen-binding protein mediates bacterial adherence to collagen; the primary sequence has a non-repetitive, collagen-binding A region, followed by instances of this B region repetitive unit. The B region has one to four 23 kDa repeat units (B1-B4), which have been suggested to serve as 'stalks' that project the A region from the bacterial surface and thus facilitate bacterial adherence to collagen. Each B repeat unit has two highly similar domains (D1 and D2) placed side-by-side; both D1 and D2 are included in this model. They exhibit a unique inverse IgG-like domain fold.
TIGR03786	strep_pil_rpt	1.40e-08	489	559	1	62	streptococcal pilin isopeptide linkage domain. This model describes a domain that occurs once in the major pilin of Streptococcus pyogenes, Spy0128, but in higher copy numbers in other streptococcal proteins. The domain occurs nine times in a surface-anchored protein of Bifidobacterium longum. All members of this family have LPXTG-type sortase target sequences. The S. pyogenes major pilin has been shown to undergo isopeptide bond cross-linking, mediated by sortases, that are critical to maintaining pilus structural integrity. One such Lys-to-Asn isopeptide bond is to a near-invariant Asn near the C-terminal end of this domain (column 81 of the seed alignment). A Glu in the S. pyogenes major pilin (column 25 of the seed alignment), invariant as Glu or Gln, is described as catalytic for isopeptide bond formation.
pfam05738	Cna_B	1.95e-08	571	671	1	87	Cna protein B-type domain. This domain is found in Staphylococcus aureus collagen-binding surface protein. The structure of the repetitive B-region has been solved and forms a beta sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL16766.1	0.0	1	1121	1	1121
CBL18305.1	3.12e-16	801	980	498	652
CAA84537.1	3.89e-14	768	960	230	397
AEE64771.1	7.58e-14	801	1059	279	502
AAT48119.1	7.62e-14	801	1059	281	504

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.924259	0.022386	0.046572	0.000210	0.000109	0.006482

TMHMM  Annotations     

start	end
21	43
1088	1110