CAZyme Information: MGYG000001375_00687

Basic Information

• Species: Ruminococcus_F champanellensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_F; Ruminococcus_F champanellensis
• CAZyme ID: MGYG000001375_00687
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
931		104592	4.9715

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001375	2513436	Isolate	not provided	not provided

• Gene Location: Start: 764926; End: 767721 Strand: -

Full Sequence      

MYKQYDLSGIWRFAMDPDKNGVREQFFATVLPDTIPLPGTTAQAKKGTYNTSRNTGYLTE
CYPFSGWAWYQTTFTPAPEDLHKPLLLTLERTRMTRLWINGTELGSCDSLTTPHCYRLPA
LEDPSPVTITICVSNTDYPTKGGHMTSPDTQTNWNGITGEISLTVLPPVHLSDLQAYPDA
AHKSVTLRGMLRGAAHTSLTVTGKAFSKDDPCIREISPIRTDLDADTEGTFSLLIPLGED
ALLWSEYTPVVYELHLSMPDVPGDAVIRFGLRSLSTKGMEFQVNGTPIMLRGKHDGMLFP
LTGAAPTDLAEWLRLLSIAKAYGINHYRYHTSCPPEAAFAAADLLGIYMQPELPFWGTLA
APGEEQYNETEQAYLVEEGFRMLRAFGSHPSFCMLSLGNELWGSSQRMGEILRDYRETDP
RHLYTQGSNNFQFWPCILEEDDFFSGVRLSKERLIRGSYANCDLPLGHIQTCRPSTDHSY
DPLIFPVQQESAEAGAAEIQIQYGTGTKTIRVDQQAEGLIPHKPIVTHEIGQYTVYPDFE
EIPKFTGVLQARNFEVFREWLRDAGMEEQARDFFLASGHLAAQCYKEEIEAVMRSRHIAG
FQLLDLQDFTGQGTALVGMLDAFMDSKGLISEKQWRGFCSDVVLLAEFDRFNYAAGEFFR
AQVQLRCYRPGLTGTAHWRLTAGDACLAAGSFPLPDAPMGLVTLGQIETRLPETEITRSL
TLTLEIPEADTENGYIIYVYPRKKPQLPPAIRVAYTAAEAQTMLDRGARVLLLPETVKEV
VEGFYCTDFWCYPMFRQICESMDRPVAVGTMGLLVDQAHPALSDFARAHCTTPQWYDLVT
HANCAVLEHAAPHIRPMVQMIDNFERNHKLGILFEARVGTGRLMVCTIRLGEIAERIEVQ
AFTDALYRYMASDRFEPRQELTPQQLTELFI

Enzyme Prediction     

No EC number prediction in MGYG000001375_00687.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	439	9.2e-58	0.4867021276595745

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.24e-27	6	563	14	539	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.58e-13	5	400	13	417	beta-D-glucuronidase; Provisional
PRK10340	ebgA	1.80e-11	7	400	44	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	5.48e-06	277	400	4	135	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	1.20e-04	7	167	4	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL16908.1	0.0	1	931	1	931
BAV13119.1	0.0	1	931	1	934
ADL53165.1	0.0	1	931	1	934
QSF47393.1	2.46e-313	1	929	1	930
ANY67160.1	3.23e-313	6	929	11	938

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZJV_A	1.00e-13	7	427	60	468	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB mutant D207A [Arthrobacter sp. 32cB],6ZJW_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant D207A in complex with galactose [Arthrobacter sp. 32cB],6ZJX_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant D207A in complex with saccharose [Arthrobacter sp. 32cB]
6ETZ_A	1.30e-13	7	427	39	447	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB [Arthrobacter sp. 32cB],6H1P_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB - data collected at room temperature [Arthrobacter sp. 32cB]
6ZJP_A	1.31e-13	7	427	60	468	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB mutant E517Q [Arthrobacter sp. 32cB]
6SEB_A	1.31e-13	7	427	60	468	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB in complex with IPTG [Arthrobacter sp. 32cB],6SEC_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cBon complex with ONPG [Arthrobacter sp. 32cB],6SED_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB in complex with galactose [Arthrobacter sp. 32cB]
6ZJQ_A	1.31e-13	7	427	62	470	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB mutant E517Q in complex with galactose [Arthrobacter sp. 32cB],6ZJR_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant E517Q in complex with lactulose [Arthrobacter sp. 32cB]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P05804	3.25e-06	7	425	15	442	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999761	0.000175	0.000071	0.000001	0.000000	0.000011

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001375_00687.