CAZyme Information: MGYG000001375_02005

Basic Information

• Species: Ruminococcus_F champanellensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_F; Ruminococcus_F champanellensis
• CAZyme ID: MGYG000001375_02005
• CAZy Family: GH98
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1034		114518.73	4.8132

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001375	2513436	Isolate	not provided	not provided

• Gene Location: Start: 2173287; End: 2176391 Strand: +

Full Sequence      

MKLKKICAALLSAALLTSSFAYASPKGTAGNDGSSLSFLGNQFQVSTMTAEAANSVMRRP
CSPDQPMLIVHIDTWNYADPAKIIALIPEDIKPYVVFNISLSINWSSTDHKWLMVQDGYE
CAKSWLKTCADEGVWCMVQPASGGQCHLPDYDSSGNIVNYPNKSQFVPHADDDYENTIYA
EFFRDYPNFIGFNYSEQFWGFESQDFPVTPIQRYQHFAKLLKLCNKYGGYLNINWCANYW
SAALNPVAMLKRCPEWRSACEQYSANLQLEEKYTQLGFSEDVESEVLGAYLSGYCGNYGV
RYDETGWSDSTWSGSGDVTKEQYRQITGLPIHMERMALNGATIIDGPELVWADDFAEKWG
GIKDGDYSCRSWDTKDQYVNDTLGFFRKLVDGTIRIPTRQEVIERTKVVVIQDNTTGDNH
NKYSTYPTLFEGLYRMSGDGNLDKNYNPYKSTGRYPTIPTVYALRDSVAKSFQVQIKQSS
IPSRWSSISAKQDEFNKLFASDYYGNCYAGRYENTWVTYNSNKDGSNCGAVLSLKYNTCK
NLDVNFNQYGNALIKEYSDRIDIYANNFDEKAQTTLRTDTFKISGCAAKPSYSAKDTGRN
QTASQISESYANGTYTLTVKHNGPVEISIQCKGNETGRLSNPKESSVKAPAYPSFYTGVR
QYEGEFFDTQNVEGNVANGCGSGVTGFWGQGFLKYGAKNNAAVRDTVSTTKAGKFDLTLR
YSATSDINNVDLYVNGSKVKTLSMPKGSSYSDWKTVTQSIDLKAGDNQVELKSNAALDGS
LYLDCFTVKGDFGTGTVEDPDPINGKIIQELTVFDKENAADWSIYYDAKVGSVLYGDRDL
TITSMPKNLVNAEAIRTACDSKLSTNDLGKFTAGADATIYTAVDTRVVENMPEWLKAWTF
AGCSVTTSNDVTLMLYKLNVKKGDVVALGTNGGSGNSANYIVFAVPQEKIVKGDVNLDGV
INGFDLILAKRGMANGFTDTRSFDAADVDKDEKLEKDDITQLQNFIKLSAKEFTETPVTK
PAPAVLTEPADDPG

Enzyme Prediction     

No EC number prediction in MGYG000001375_02005.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH98	56	394	5.6e-151	0.9877675840978594
CBM35	683	788	6.6e-21	0.865546218487395

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08306	Glyco_hydro_98M	2.55e-161	52	394	1	328	Glycosyl hydrolase family 98. This domain is the putative catalytic domain of glycosyl hydrolase family 98 proteins.
cd04083	CBM35_Lmo2446-like	9.27e-37	660	788	1	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04082	CBM35_pectate_lyase-like	4.63e-15	685	788	20	124	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
pfam08307	Glyco_hydro_98C	9.27e-14	399	632	1	270	Glycosyl hydrolase family 98 C-terminal domain. This putative domain is found at the C-terminus of glycosyl hydrolase family 98 proteins. This domain is not expected to form part of the catalytic activity.
cd14256	Dockerin_I	7.72e-10	952	1007	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL18082.1	0.0	1	1034	1	1034
ADU21039.1	0.0	1	947	1	939
ADL51037.1	0.0	1	970	1	973
BAV13045.1	0.0	1	970	1	973
BAV06735.1	1.10e-223	50	812	27	760

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WMF_A	7.42e-21	181	629	135	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in its native form. [Streptococcus pneumoniae TIGR4]
2WMH_A	2.28e-20	181	629	135	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 in complex with the H- disaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]
4D6C_A	4.58e-14	87	568	46	482	Crystalstructure of a family 98 glycoside hydrolase catalytic module (Sp3GH98)(L19 mutant) [Streptococcus pneumoniae SP3-BS71],4D6G_A Crystal structure of a family 98 glycoside hydrolase catalytic module (Sp3GH98) in complex with the blood group A-trisaccharide (L19 mutant) [Streptococcus pneumoniae SP3-BS71]
4D6E_A	6.04e-14	87	568	46	482	Crystalstructure of a family 98 glycoside hydrolase catalytic module (Sp3GH98) in complex with the blood group A-trisaccharide (X01 mutant) [Streptococcus pneumoniae SP3-BS71]
4D6D_A	6.04e-14	87	568	46	482	Crystalstructure of a family 98 glycoside hydrolase catalytic module (Sp3GH98) in complex with the blood group A-trisaccharide (X02 mutant) [Streptococcus pneumoniae SP3-BS71]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6RUF5	2.37e-08	201	568	351	698	Blood-group-substance endo-1,4-beta-galactosidase OS=Clostridium perfringens OX=1502 GN=eabC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000346	0.998882	0.000184	0.000226	0.000204	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001375_02005.