CAZyme Information: MGYG000001376_00303

Basic Information

• Species: Dysgonomonas gadei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas gadei
• CAZyme ID: MGYG000001376_00303
• CAZy Family: GH5
• CAZyme Description: Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	MGYG000001376_1|CGC6	54249.51	4.4431

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001376	5166013	Isolate	not provided	not provided

• Gene Location: Start: 379286; End: 380758 Strand: -

Full Sequence      

MRIFKYTLTLLCLLLPFWACGDDDDPITEPSIEASISATPTTFPFEADGGTSKMEITSNT
TWRIDFPSDSWVKPSIQTAKGNASVTITADPNDLEESRSATFTLSATGAENITITLTQAA
KTPDPVIPDYIDPDKTGMDSDAPALATKMKIGWNLGNSLEATDGTSAGETSWGNAKTSKK
LIDGVKAAGFNTVRIPCAWNAYLEDQTTYKIKDSWLARVKEVVDYCVDNDMYAIINIHWD
GGWLEENPTYDKQEEVNKKQKALWKQIAIYFRDYDEHLLFAGTNEVHKDYGTPTAENIEV
QLSYNQSFIDAVRATGGRNAWRNLIVQAYNTNIDLAVSSLKMSTDATANRMMAEVHYYDP
YEFCLQENNSVFLWGKDFTGAGTASWGQEDWADTQFARMKTNFVDKGFPVILGEYAASLR
TSLPAADYANHIKARNYYLNYITKAALKNGMVPVYWDNGVTGDKASGLFDRATGEQVHAD
AISAIIDAGN

Enzyme Prediction     

EC	3.2.1.151	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	169	459	1.6e-101	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.55e-50	169	459	16	269	Cellulase (glycosyl hydrolase family 5).
cd14948	BACON	3.26e-18	35	119	1	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
COG2730	BglC	1.03e-15	149	417	51	323	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam19190	BACON_2	6.68e-08	36	121	2	91	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.
pfam13004	BACON	7.05e-08	67	119	7	61	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK55671.1	8.58e-237	1	488	1	488
QIK61079.1	7.01e-236	1	488	1	488
BAF57333.1	3.05e-160	138	488	20	372
QGY45078.1	3.10e-159	5	473	2	469
ADQ18612.1	5.41e-154	127	486	186	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZMR_A	2.83e-119	45	490	19	467	Bacteroidesovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus],3ZMR_B Bacteroides ovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus]
5OYC_A	1.99e-104	133	487	36	391	GH5endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYC_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107]
6HA9_A	1.59e-103	133	487	36	391	Structureof an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HA9_B Structure of an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_A Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_B Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107]
4W8A_A	2.03e-82	141	485	2	367	Crystalstructure of XEG5B, a GH5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in the native form [uncultured bacterium],4W8B_A Crystal structure of XEG5B, a GH5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in complex with XXLG [uncultured bacterium]
2JEP_A	7.66e-78	140	486	33	391	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXT7	6.34e-119	10	490	23	502	Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02653 PE=1 SV=1
O08342	7.45e-76	142	486	40	396	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P23660	2.75e-58	139	473	24	347	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P54937	2.68e-57	142	486	39	375	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P28621	2.69e-56	135	471	34	356	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000356	0.114006	0.885421	0.000068	0.000077	0.000070

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001376_00303.