CAZyme Information: MGYG000001376_00327

Basic Information

• Species: Dysgonomonas gadei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas gadei
• CAZyme ID: MGYG000001376_00327
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790	MGYG000001376_1|CGC7	90030.13	6.7367

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001376	5166013	Isolate	not provided	not provided

• Gene Location: Start: 417782; End: 420154 Strand: -

Full Sequence      

MKRIYIITGLIVSTLCMNAQLKPKVETFSLKDVRLLDSPFKHAEDLDKQYLLELKADRLL
SPFLRESGLTPKAESYTNWENTGLDGHIGGHYLSALSLMYASTGDKQIKERLDYMVSELK
RCQDANDNGYIGGVPGGKAIWEEVANGNIRAGGFDLNGKWVPLYNIHKTYAGLRDAYLYA
NSDMAKEMLIKMTDWAINLVSKLSEEQIQDMLRSEHGGLNETFADVAAITGDKKYLKLAH
QFSHQLVLNPLLNHEDKLTGMHANTQIPKVLGFKRIADVEGNESWSEASRFFWETVVEHR
SVSIGGNSVGEHFNPTNDFSRVIKSIEGPETCNTYNMLRLSKMLYQTSQDEKYMDYYERA
LYNHILSTQNPEQGGFVYFTQMRPGHYRVYSQPQTSFWCCVGSGIENHAKYGEMIYAHTD
NELYVNLFIPSRLNWKEKKTEIIQENSFPDEAKTQLIINPEKTAAFTLKLRYPVWVKKWG
LKVSVNGKDYPVSQDPASYISIDRKWKKGDKVVVEMPMRITVEQLPDKSNYYSIFYGPVT
LAAKTGTEDMTGLFADDSRGGHIAHGRQIPMKDMPIIVSDPARIASLVKPVQGKPLTFHL
SGLYPDKYASGLELIPFFRLHESRYIIYWPQATAEGVKEIQQKIEDEERERIKLDGITAD
KVVCGEQQPESDHFIQSDKSNTGFIEDIHWREARGWFSYQLKNTGKNANYLYLKYFDRDQ
NRNFDVFVNGRKVASLSLNGDGGDNLFTSTYPVPESEKGKEILEVKIMAATNSVTTKIAE
VRVLSEDYKH

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	32	542	1.7e-219	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	32	542	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.84e-120	17	618	1	571	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	1.19e-41	546	629	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK52968.1	0.0	1	786	1	785
SCD19719.1	0.0	18	786	20	787
QRX64622.1	0.0	2	788	5	790
CDT01493.1	0.0	7	785	10	787
AZA94403.1	0.0	19	789	18	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	4.76e-313	1	784	1	801	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.37e-302	7	784	7	801	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	8.74e-23	159	520	131	534	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	7.68e-21	230	518	206	517	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QK0_A	2.34e-20	159	517	131	531	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003983	0.624738	0.370074	0.000483	0.000383	0.000315

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001376_00327.