CAZyme Information: MGYG000001376_00418

Basic Information

• Species: Dysgonomonas gadei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas gadei
• CAZyme ID: MGYG000001376_00418
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
957	MGYG000001376_1|CGC11	105000.12	6.395

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001376	5166013	Isolate	not provided	not provided

• Gene Location: Start: 565726; End: 568599 Strand: +

Full Sequence      

MKKKTKAFICLLCVLFFSTIAVAQNNIAGISTSVNEKTVNAVADNNLKTNWKLASKDLQK
AEWLMFSLQKAGDVNAITIDCEGITPQELQKLLSVYITYDPMNLGVPVSYTVSAKGKVSV
LSFTPKYGAHVRFVFKEGVLKKDLLIKEVSVSILDKKAEIANVPLKERAYMNPNLPLESR
VEDLLSVMTVEDKMELLREGWGIPGIPHLGVPAIHKVEAIHGFSYGSGATIFPQSIGMGA
TWNKRLIEAAAMAIGDETVSANAVQAWSPVLDVAQDARWGRCEETYGEDPVLVTEIGGAW
IKGYQSKGLMTTPKHFAAHGAPLGGRDSHDIGLSEREMREIHLVPFRDIYKKYKYQSIMM
SYSDFLGVPVAKSKELLKGILRDEWGFDGFIVSDCGAIGNLTARKHYTAVDKVEAARQAL
AAGIATNCGDTYNDPDVIAAAKRGELNMDDLDFTCKTLLRTLFRNGLFENNPCKPLDWNK
IYPGWNSPEHQALARKTAQESIVLLENKGNILPLSKSLKTIAVIGPGADNLQPGDYTSKP
QPGQLKSVLTGIKAAVNSSTKVLYEEGCRFIGTEGTDIAKAVKAAENADVAVLVLGDCST
SEALKGITNTSGENHDLATLILPGEQQKLLEAVCKTGKPVVLILQAGRPYNLSYAAENCQ
AVLVNWLPGQEGGYATADVLFGDYNPAGRLPMTFPRDAAQLPLYYNFKTSGRVYDYVDMP
YYPLYQFGYGLSYTSFNYSDLNISLEKNGNVSVNATVTNTGKVAGDEVVQLYITDMYASV
KTRVMELKDFDRVYLNPGESKKVSFVLTPYQLSLLNDEMDRVVEKGLFKIMVGGKSPSYV
AKDRIKDSVGFIEAKDGINGEIDYPLNFNADFAITVVSVEDQPGKDAKVANVLVTNTGNL
TDTGKLMMYLDGKKIGDTRHYDLEPGEEKQFQIEVSQSNFKTLQFTSKYKSVTYTSK

Enzyme Prediction     

No EC number prediction in MGYG000001376_00418.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	206	426	4.2e-69	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.16e-163	172	833	26	751	beta-glucosidase BglX.
PLN03080	PLN03080	4.28e-107	170	833	42	769	Probable beta-xylosidase; Provisional
COG1472	BglX	8.93e-86	195	556	44	387	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	2.06e-70	502	733	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.51e-57	209	460	64	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO67869.1	0.0	25	950	25	950
QUT89549.1	0.0	25	950	25	950
QQA09894.1	0.0	24	952	24	952
QUT39633.1	0.0	24	952	24	952
QMW89388.1	0.0	24	952	20	948

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	1.38e-113	170	836	7	745	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5TF0_A	2.64e-113	209	838	81	742	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
7EAP_A	1.02e-112	170	836	7	745	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
6R5I_A	7.36e-108	209	833	70	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	3.88e-107	209	833	70	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.51e-130	172	836	28	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	3.62e-115	172	833	63	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.02e-113	206	836	99	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
P14002	3.90e-92	181	846	5	667	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
T2KMH9	2.83e-91	166	839	25	747	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000284	0.999004	0.000173	0.000182	0.000169	0.000154

TMHMM  Annotations     

start	end
7	24