CAZyme Information: MGYG000001376_00420

Basic Information

• Species: Dysgonomonas gadei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas gadei
• CAZyme ID: MGYG000001376_00420
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000001376_1|CGC11	43246.98	5.429

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001376	5166013	Isolate	not provided	not provided

• Gene Location: Start: 570637; End: 571758 Strand: -

Full Sequence      

MKHLLVFTLLTLILLSCKQKEEVENKILPIDKNATKETVVLYNRLFSLMDKGIMVGHQDD
LAYGHAWYKEAGRSDVKDVTGDYPAVIGWELGHVETGAEFNLDSIYFSDMKRYIKETYDR
GGITTVSWHGDNIVTGNTAWDCAQDSVVRTILPNGSNHEKYLVWLDRVADFFLDLKDKDS
NYIPVIFRMYHEHTGAWFWWGSKQCTPDEYKKLWIMTVEYLRDKKNVHNLLYTYSPSETE
SEEAYLERYPGDKYVDIVGYDSYVNGKSPEDIERYKDAMSRNLKIVTDYASKTNKVPVIG
ETGMESIPDSTYFTNIVYPIITQHKVAWALFWRNAWEPDKPLHYYMPYGGHPAAEDLNVF
IGKPSILMNRDIN

Enzyme Prediction     

No EC number prediction in MGYG000001376_00420.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	31	339	5.6e-64	0.9174917491749175

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	4.28e-42	30	297	1	264	Glycosyl hydrolase family 26.
COG4124	ManB2	1.52e-15	166	263	169	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIA99594.1	5.76e-219	14	372	7	366
QIK53347.1	3.11e-206	14	372	15	372
QIK58764.1	2.55e-205	2	372	3	372
BCI64729.1	1.15e-186	1	372	1	369
QUT74990.1	2.82e-176	1	372	1	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	9.68e-102	35	371	9	338	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX4_A	4.73e-79	30	372	34	391	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	4.73e-79	30	372	34	391	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	9.07e-79	30	372	57	414	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	3.73e-78	30	372	34	391	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	2.69e-60	30	372	50	411	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	1.39e-44	31	368	44	394	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	1.05e-20	2	336	4	328	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P16699	3.47e-18	33	338	38	334	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1
P49425	2.24e-17	31	336	148	429	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000073	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001376_00420.