CAZyme Information: MGYG000001376_01094

Basic Information

• Species: Dysgonomonas gadei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas gadei
• CAZyme ID: MGYG000001376_01094
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000001376_2|CGC6	43808.91	8.5957

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001376	5166013	Isolate	not provided	not provided

• Gene Location: Start: 349468; End: 350610 Strand: +

Full Sequence      

MKYFLVAGEASGDLHGSNLMAALKEQDANAEFCFLGGDLMQAQGGRLVKHYREMAFMGFI
PVLLNLRTILRNMKMCNEEIIRFQPDVLILIDYPGFNLKVAKYIKTHTQIPVYYYISPKV
WAWKEYRVKSFKKYVDEMLSILPFEVDFYKKHNYRIDYVGNPVVDAVANFREENKDDTRD
KFISENKLDNKPIIALLAGSRQQEIKDNLPAMLESIEKFTDYQPVIAGAPAIEADYYKKY
IGDKPCKIIFGQTYRLLEYSEAALVTSGTATLETALFRVPQVVCYETPIPHVVYWVFKNV
LHTKYISLVNLISDKTVVQELFAKFFSVEAIRNETDRLLNDIPYRNRMLSEYDEIINILG
KPGASGHAAKIIIDKLKKRK

Enzyme Prediction     

No EC number prediction in MGYG000001376_01094.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	358	6.1e-116	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.08e-115	1	380	2	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.02e-101	1	378	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.39e-74	4	321	2	321	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.21e-62	5	374	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	6.42e-51	1	372	1	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK59046.1	1.75e-211	1	376	1	376
QIK53577.1	5.01e-211	1	376	1	376
ABR44355.1	2.07e-174	1	376	1	375
QRO15504.1	2.07e-174	1	376	1	375
QCY57761.1	2.07e-174	1	376	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	9.88e-36	5	321	11	327	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.90e-35	5	321	11	327	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.82e-63	2	376	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	2.78e-58	5	378	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B6J161	4.98e-57	5	372	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
B6J9H1	7.00e-57	5	372	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
A9KC41	7.00e-57	5	372	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000014	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001376_01094.