CAZyme Information: MGYG000001376_01531

Basic Information

• Species: Dysgonomonas gadei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas gadei
• CAZyme ID: MGYG000001376_01531
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
273	MGYG000001376_3|CGC5	31770.76	4.798

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001376	5166013	Isolate	not provided	not provided

• Gene Location: Start: 204403; End: 205224 Strand: -

Full Sequence      

MNKTSSYGFPPNPIEKQGHTLEFQDEFELSVLNTDNWIPCYLPQWSSREKSRPNYHFSDG
NLVLEITDDQQPWCPEFNGEVKCSSLQTGLYAGPLGTDKGQHKFNEKCIVREEQISHKKY
LPQYGYFEIRAKVPDTVSNVAAFWMIGYEEQPEQSAEICIVEIKGCNVEKESSIIGYGIH
RFNDPALEEAFHEERFNMDVTQFHIYAADWGPEKVDFYIDNKLIRSIKQSPAYPMQFMLN
IYELPTGKEKIGSDLIYPKEFTIDYIRGYRKIQ

Enzyme Prediction     

No EC number prediction in MGYG000001376_01531.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	24	269	1.6e-97	0.995850622406639

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00413	Glyco_hydrolase_16	5.39e-40	25	269	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08023	GH16_laminarinase_like	1.19e-21	23	269	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02178	GH16_beta_agarase	1.06e-20	22	270	24	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
pfam00722	Glyco_hydro_16	3.58e-12	116	242	27	146	Glycosyl hydrolases family 16.
COG2273	BglS	6.64e-10	115	270	109	264	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKJ63771.1	4.17e-133	5	270	6	270
ANE46460.1	1.52e-116	9	271	6	268
QNA46673.1	8.26e-114	9	271	8	270
QSI76718.1	1.74e-112	10	271	5	266
AYQ72162.1	1.76e-110	5	271	2	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UPS_A	1.80e-46	9	272	20	280	GlcNAc[alpha]1-4Galreleasing endo-[beta]-galactosidase from Clostridium perfringens [Clostridium perfringens],1UPS_B GlcNAc[alpha]1-4Gal releasing endo-[beta]-galactosidase from Clostridium perfringens [Clostridium perfringens]
5WUT_A	1.17e-16	17	270	3	235	Crystalstructure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]
3ILN_A	3.66e-08	124	273	85	251	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]
6T2N_AAA	9.59e-08	124	270	145	303	ChainAAA, Glycoside hydrolase family 16 protein [Akkermansia muciniphila],6T2N_BBB Chain BBB, Glycoside hydrolase family 16 protein [Akkermansia muciniphila]
4BQ1_A	1.70e-07	19	270	11	256	Crystalstructure of of LamAcat from Zobellia galactanivorans [Zobellia galactanivorans],4BQ1_B Crystal structure of of LamAcat from Zobellia galactanivorans [Zobellia galactanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33680	2.84e-07	116	269	310	457	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1
P45798	8.17e-07	124	273	120	286	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
Q9Z3Q2	2.92e-06	116	269	310	457	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000086	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001376_01531.