CAZyme Information: MGYG000001376_02347

Basic Information

• Species: Dysgonomonas gadei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas gadei
• CAZyme ID: MGYG000001376_02347
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	MGYG000001376_5|CGC6	36366.98	6.6256

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001376	5166013	Isolate	not provided	not provided

• Gene Location: Start: 356010; End: 356969 Strand: +

Full Sequence      

MKNIILTCLLLFSTVFYAQEKTEMTVDRNGTGDFRNIQEAINSVRTADPRGTITIFIKNG
VYKEKLIIPPHITNIRLIGEDRNTTIINYDDHANINKMGTFKTYTFLLSGNDITLENLTI
ENSSAELGQAVALHIEGDRVILRNCRLLGHQDTLYAGRDGARQYFENCYIEGTTDFIFGP
STAWFEKCTIHCKRNSYITAANTPENIRYGYIFNNCTITMANGVNAVYLGRPWRAYSMTL
FMNCTLPKEINTTGWDNWRNADNEKTVRYMEYNNKGEGANTSSRVKWAKILSSNEAKEYT
IENVLNGCDNWNPLTNTDQ

Enzyme Prediction     

No EC number prediction in MGYG000001376_02347.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	24	306	1.6e-106	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.33e-73	25	307	3	297	Pectinesterase.
PLN02773	PLN02773	5.05e-73	24	299	7	290	pectinesterase
PLN02432	PLN02432	8.51e-71	24	307	13	288	putative pectinesterase
COG4677	PemB	2.39e-68	33	307	93	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	2.94e-62	24	314	71	369	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK53311.1	1.12e-169	1	313	1	313
QIK58728.1	1.30e-168	1	313	1	313
QQY38333.1	1.23e-128	5	314	4	315
ALK82867.1	1.23e-128	5	314	4	315
QEW38158.1	1.23e-128	5	314	4	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	4.83e-43	24	300	9	297	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	6.91e-42	26	307	7	300	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	6.10e-37	24	284	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	3.27e-36	24	284	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	4.63e-32	34	313	18	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.30e-55	26	299	9	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	8.23e-52	21	315	255	560	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
O49298	1.82e-50	21	307	248	539	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
Q7Y201	3.20e-50	21	307	299	597	Probable pectinesterase/pectinesterase inhibitor 13 OS=Arabidopsis thaliana OX=3702 GN=PME13 PE=2 SV=2
Q9FM79	3.22e-50	24	311	82	377	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000287	0.998990	0.000229	0.000172	0.000168	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001376_02347.