CAZyme Information: MGYG000001376_02357

Basic Information

• Species: Dysgonomonas gadei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas gadei
• CAZyme ID: MGYG000001376_02357
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
716	MGYG000001376_5|CGC6	80951.97	7.3518

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001376	5166013	Isolate	not provided	not provided

• Gene Location: Start: 368561; End: 370711 Strand: -

Full Sequence      

MKKQGILLTLSLIFLINNFNLFAQKKQEKVNDFNTPLHLLTPDYNTPYRELTEKDIKASL
DRVLKYLDEATPARVVDKDSHKAITDLSKVDKNAILERGNFRLASYEWGVTYSGMLEVAK
ATGDKAYYKYVDDRFRFLSDAAPHFKRLMNDYGVIDPQMKQMLTPHALDDAGAMCAAMIK
LQQDKPDYELRSIIDNYMNYIMYKEYRLSDGTFARKRPQMNTLWLDDMYMSIPAIVQMGK
LTGDAKYYNEAAKQIKQFSERMFVKEKGLYMHGWVESMTEHPAFFWGRANGWAVLTMTEV
LDVLPENHPERQRILEQLRAHIKGIVSYQSGEGFWHQLLDRNDSYLETSATAIYVYCIAR
AINKGWIDPLAYGPVAQLGWNAVSTKINSAGEVEGTCVGTGMAFDPAFYYYRPVNVYAAH
GYGPVLLAGAEMINLLKKFYPRMNDSAIQYYTSPQTTKSPIFGIEDSTRPDAIASGSSRV
NDKAPVIFLIGDSTVKNGRGKGDGGQWGWGSFFQQFFDTTRISVENHALGGRSSRTFFTE
DLWNKVLPGIRKGDYLFIQFGHNDGGPLNTGRARASLNGTGDESQVVIMERNGGPEEVFT
FGHYLRIYIRQAKAVGAIPVVLSPTPGNRWTNGKMNRMTETYTRWAKEVAQQEGVEFIDL
NDRTADKCDTMGEEKGKQLFVDSVHTTYDGAIINGQSVIEGLQSLNGFSLNQYILK

Enzyme Prediction     

No EC number prediction in MGYG000001376_02357.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	101	433	3.9e-98	0.9668674698795181
CE12	487	702	3.1e-58	0.9904761904761905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	7.54e-98	106	436	29	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
cd01821	Rhamnogalacturan_acetylesterase_like	3.42e-69	485	702	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
COG4225	YesR	1.33e-55	106	436	36	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
COG2755	TesA	7.18e-16	483	707	7	213	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
pfam13472	Lipase_GDSL_2	2.71e-09	489	666	1	153	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK54909.1	0.0	12	716	11	715
QIK60340.1	0.0	12	716	11	715
SCD19753.1	0.0	1	716	1	715
ADQ18031.1	0.0	29	714	20	700
QRX63316.1	0.0	2	714	3	710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	9.89e-205	26	465	2	443	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	2.82e-30	106	437	41	369	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.07e-29	106	437	31	359	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
1DEO_A	1.41e-27	486	702	2	212	RHAMNOGALACTURONANACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.55 A RESOLUTION WITH SO4 IN THE ACTIVE SITE [Aspergillus aculeatus],1DEX_A RHAMNOGALACTURONAN ACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.9 A RESOLUTION [Aspergillus aculeatus],1K7C_A Rhamnogalacturonan acetylesterase with seven N-linked carbohydrate residues distributed at two N-glycosylation sites refined at 1.12 A resolution [Aspergillus aculeatus],1PP4_A The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus],1PP4_B The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus]
3QWT_A	5.92e-27	72	415	17	360	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.55e-29	106	437	41	369	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
Q00017	4.62e-27	484	702	17	229	Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus OX=5053 GN=rha1 PE=1 SV=1
Q5BAA2	1.40e-26	472	716	5	237	Rhamnogalacturonan acetylesterase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN2528 PE=1 SV=1
P9WF04	4.84e-22	219	433	196	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	3.80e-21	105	440	28	343	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000486	0.998468	0.000537	0.000191	0.000161	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001376_02357.