CAZyme Information: MGYG000001376_02406

Basic Information

• Species: Dysgonomonas gadei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas gadei
• CAZyme ID: MGYG000001376_02406
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	MGYG000001376_6|CGC2	46869.17	5.2757

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001376	5166013	Isolate	not provided	not provided

• Gene Location: Start: 44322; End: 45554 Strand: -

Full Sequence      

MKLRNVILGISTSLLLFSCTQKNTSEDFDVDKNLIYCNTQIQRTLSEISGKQMMPRNIMD
SLTHWKLVPIEISEWTIGFWPGILWYNYENTKNPTDADVATYYTDLLEPLTKLPAYDHDL
GFQIFCSYGNAYRLTGNEKYKQIILNAADTLATLFNPKVGTILSWPREVEPNNWPHNTIM
DNMINLEMLFWAAKNGGDKKLYEIATKHAETTMKHHFREDGGNYHVAVYDTITGDFIKGV
THQGYADSTLWARGQAWAIYGYAMVYRETQDKTFLRFAEKVTDLYLNRLPKDEYVPFWDF
DAPNIPNEPRDASAAAIVASGLLELSQLEDNPQKAQEYKTAAINMLIELSSDKFQSGACK
PSFLLHSVGHWPNGSEVDAAINYADYYYIEALIRYKKMMNGLSVIENLKG

Enzyme Prediction     

No EC number prediction in MGYG000001376_02406.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	72	395	3.9e-125	0.9817629179331308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.48e-18	51	398	3	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU95298.1	7.97e-182	3	405	1	405
QQR18022.1	1.13e-181	3	405	1	405
ANU57112.1	1.13e-181	3	405	1	405
QDH55123.1	9.23e-181	3	405	1	405
QUT22828.1	1.31e-180	3	406	1	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	6.77e-88	53	398	54	391	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	1.54e-54	73	397	66	391	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.58e-54	73	397	67	392	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	2.21e-54	73	397	67	392	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	8.51e-54	73	397	67	392	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	7.51e-80	2	399	3	398	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8DR77	2.45e-57	73	400	65	393	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	4.23e-55	73	400	68	396	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	8.63e-54	73	397	67	392	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	8.66e-51	66	401	33	370	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000038	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001376_02406.