CAZyme Information: MGYG000001376_02411

Basic Information

• Species: Dysgonomonas gadei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas gadei
• CAZyme ID: MGYG000001376_02411
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
644	MGYG000001376_6|CGC2	73977.14	7.1857

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001376	5166013	Isolate	not provided	not provided

• Gene Location: Start: 52761; End: 54695 Strand: -

Full Sequence      

MKKIYIIILSLFCQLSINAQSVYPGQHLDKIKQPLNGEVKAFSFDLKDVRLLDSPFRQNM
ERESKWILSLGVDRLLHSFRNTAGVYAGREGGYMTIKKLGGWESLDCELRGHSIGHIMSG
LAYLYASTGDERYKIKADSLVAGLAEVQDILIENGQKGYISAYPENLINRNIAGKSVWAP
WYTLHKVYAGLIDQYLYCDNKEALDIMKEAASWAYQKLMPLSEEQRALMLRNEFGGVNEA
FYNLYAITGNPEHKKSAEFFYHADVIDPLAEHKADLYFKHANTFIPKVIGEARNYELHNS
ERSKDIANFFWNTVIDHQTYCTGGNSHKEKFIHSDSISKNLTGYTQETCNTNNMLKLTRH
LFCWDANAKYADYYERALYNHILGQQDPQSGMVAYFLPMLPGAHKVYSTPENSFWCCVGT
GFENHAKYGEAIYYHDNNGLYVNLFIPSELTWKEKGIKIKQETAFPEEGNICLTVTTDKD
IKMPVYLRYPSWTSNVEVKVNGKKTKIKQSPSGYITIDRTWKNGDKIEVHYPMHLYLTET
NDNPDKAAIMYGPLVLAGTMGTEGMKAPAPFSNPELYNDYYTYDYNVPDSMKTGLKLDKK
NLEQYIKSVSGNPLTFYVEKENVRLEPIYRIHHQRYVVYWDLLK

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	48	557	1.1e-201	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	48	557	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.25e-120	46	561	9	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	3.24e-10	598	640	35	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY54289.1	0.0	1	644	1	644
QUT92215.1	9.56e-304	1	644	1	640
ALJ62034.1	7.80e-303	1	644	1	640
QRQ56375.1	2.23e-302	1	642	1	637
SCV09028.1	2.40e-302	1	642	3	639

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.56e-121	32	640	18	648	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	2.96e-117	32	640	18	648	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	1.72e-23	301	555	286	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.90e-22	301	555	286	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	4.06e-18	118	555	76	543	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001032	0.997965	0.000324	0.000237	0.000215	0.000200

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001376_02411.