CAZyme Information: MGYG000001376_02463

Basic Information

• Species: Dysgonomonas gadei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas gadei
• CAZyme ID: MGYG000001376_02463
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
887		99592.31	7.0781

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001376	5166013	Isolate	not provided	not provided

• Gene Location: Start: 131911; End: 134574 Strand: -

Full Sequence      

MQKKKCLIFTIISFLFIAISCSLNASITVYDLKCENLTNPNAIDNTSPHLSWKIKYTKGA
MQQQYYEIQVASDSMSLLGNKADLWNSGKQKSAASVMVPYKGKGLASRSLCYWRVRVWNS
KNEVSGWSEINRFGVGIIDKEDAQGSYIGLSPAAGNIQSPILRKSFNVTGINTSFLHVNA
LGYCEVYINGRKVSDDVLSPAVSQLNKRSLIVTYDVTPYLKEGKNDLVLWLAKGWYRKNT
FDAVYDGPLVKAQLDIKESNGWNTLVATDSSWKGRHGGYIETGIWQALRFAGEKLDGRVL
PKDLNPTTLDQMSWYPVAEIGVPEHKATPVMTEPDKIQETLMPQNITQLGDSTWLVDMGK
VLNGWFKIRLPQLNEGQEVLMEYTDFMKEGKFDDQGQSDIYVGVGNGTDVFCNKFHSHAF
RYIRISNLAAKPNKEDIKAYLIHTDYHQASTFECSDPELNAIHNMIQYTMKCLAYSGYMV
DCPHLERAGYGGDGNSSTESLQTMYNVAPLFTNWMQAWDDSMREGGSLPHVAPNPGAGGG
GPYWCGFIIMAPWQTYLNYNDPRLIEKHYPAMKEWLGYVEKYTVDGLLKRWPDTPYRDWF
LGDWLAPIGVDSGNERSINLVNNCFVSDCFSKMEKIAGILGKPDEAKEFASRRDKLNQLL
QKTYYNKDEKMYSTGSQLDMSYPMLVGVTPPTLYDEVKERLLSLTAERHNNHIAVGLVGV
PILTKWAIENKAADFMYTMLKKHDYPGYLHMIDNGATTTWEYWSGERSRVHNCYNGIGMW
FYQAVGGIRTDEDKPGYQHVIIEPQIPEGVSWAKTTKESPYGTISVDWKLTDGKLTINAV
LPVGSTGSVILPRNATGCKLNGKAVKAKNNSVAINNGSYSLEILLGN

Enzyme Prediction     

No EC number prediction in MGYG000001376_02463.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	346	851	2.3e-130	0.998015873015873
CBM67	158	324	1.5e-21	0.8920454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.66e-113	448	785	2	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.10e-38	171	339	3	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	1.51e-20	787	858	1	70	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	2.90e-19	347	443	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT32844.1	0.0	31	879	31	881
SCV08345.1	0.0	31	879	36	886
QRQ55739.1	0.0	31	879	36	886
ALJ48925.1	0.0	31	879	36	886
QGT73477.1	0.0	31	879	34	884

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.36e-102	30	853	33	900	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	9.44e-77	26	852	1	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	9.34e-65	171	852	316	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	2.27e-99	38	881	41	947	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	2.29e-96	35	885	38	912	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	3.41e-94	35	884	42	912	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	4.67e-64	171	852	316	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001121	0.313006	0.685237	0.000247	0.000186	0.000180

TMHMM  Annotations     

start	end
7	29