CAZyme Information: MGYG000001376_02537

Basic Information

• Species: Dysgonomonas gadei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas gadei
• CAZyme ID: MGYG000001376_02537
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000001376_6|CGC8	45037.54	8.0913

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001376	5166013	Isolate	not provided	not provided

• Gene Location: Start: 270512; End: 271666 Strand: +

Full Sequence      

MYKKIFILLFVFSTQLSFAQSYDLKNFPEGCEPEFIGKKLTERYLQTPHSHWGNINSEHK
VTFVTYPDVCAWLGALWFTQSVKDENLYNKLVDRFDPLFTTEKDFLPTLRPTAHNVVDWY
VFGAVPLEIYKKKKEQKYLDLGMKYADGQWILPENPKDYEKEWHDKGYSWQTRLWIDDMF
MITAVQDQAYLVTGDKKYIDRSANEMALYLDRIQRENGLFYHAPEAPFFWGRGNGWMAVG
MAELLRILPKDNPHNEKIKEAYKKMMKTLLRYQGYDGMWGQLIDDPNSWRETSGTAMFTY
AMIVGVKNGWLDKKTYGAAARKGWLALLTYLNEDYNLRNVCEGTGTKNDYNHYINRKRLI
GDMHGQAALMWCAYGLASDDVKRK

Enzyme Prediction     

No EC number prediction in MGYG000001376_02537.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	61	374	1.6e-72	0.9578313253012049

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.53e-47	129	374	84	337	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	7.58e-39	66	370	36	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWO00682.1	1.43e-194	19	380	39	403
QEH42438.1	3.34e-193	19	377	39	400
SCD21779.1	5.03e-180	20	379	40	387
BBE16470.1	3.30e-169	7	376	9	373
ALJ58453.1	2.93e-166	19	373	23	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	1.11e-29	174	371	199	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	1.23e-26	123	370	93	358	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.21e-26	123	370	83	348	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	9.24e-21	145	329	124	326	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	3.99e-19	39	329	22	309	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	6.72e-26	123	370	93	358	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	1.98e-20	48	334	79	372	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	7.64e-19	123	334	121	336	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	8.69e-18	136	334	131	337	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
O31521	1.33e-13	66	367	31	328	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000319	0.998969	0.000176	0.000165	0.000159	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001376_02537.