CAZyme Information: MGYG000001376_03874

Basic Information

• Species: Dysgonomonas gadei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas gadei
• CAZyme ID: MGYG000001376_03874
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684	MGYG000001376_14|CGC1	77988.56	6.2514

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001376	5166013	Isolate	not provided	not provided

• Gene Location: Start: 43532; End: 45586 Strand: +

Full Sequence      

MKKGLLNSLIAVTLFLCSNSISASGGDIDVTIVNRPSVKALNNHYTSNKAPLLPNNFIKL
PVGKVQPKGWTKRMLELQRDGLAGQLGEISAWLNKKNNAWLNAGGEYGWEEVPYWLKGYG
NMAYILNDPKMLAETKIWIEAAIKSQQADGYFGPVNERDGKRELWANMIMLWCLQSYYEY
SNDKRVIDLMTNYFKWQLTVPDEKFLKDYWENSRGGDNIYSVYWLYNITGDSFLLELVHK
IHRNTANWMLDSTLPNWHNVNIAQGFREPATYYMLTKDPAHLHATYNVHDLIRRTFGQVS
GGMFGADENARMGYIDPRQGTETCGFVEQMASDEMMLWYTGDPLWAEHCENIAFNSYPAS
MMPDLKSLRYITCPNHVQSDSENHKPGIDNGGPFLAMNPFSSRCCQHNHAQGWPYFIENL
ILATPDNGVAAAIYAACEAKVKVGDGTEVTIGEDTQYPFDGAIRFRVNTPKKVRFPFYLR
IPSWTKNAQLEINGKKIPADLVAGKYACINREWDNGDIVKVTYPMEFSLKTWQVNKNSVS
VDYGPLTLSLNIDEEYKKVDSKESAIWDSKWQESADPSKWPSYEIYPKTAWNYALVLDPE
KPFSNLVVEKRTWPADNYPFTQQNSPLVIKAKGRQIPSWKLDQYKLCGVLPDEDCEKSSQ
IDDIILVPMGTARLRITSFPASYE

Enzyme Prediction     

No EC number prediction in MGYG000001376_03874.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	321	547	9.7e-32	0.4217557251908397

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.05e-120	29	549	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.23e-18	108	550	57	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07678	A2M_comp	5.47e-04	70	153	53	134	A-macroglobulin complement component. This family includes the complement components region of the alpha-2-macroglobulin family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCL79118.1	5.26e-175	34	680	28	662
CAD5918643.1	7.55e-173	40	682	39	667
CAD5991834.1	7.55e-173	40	682	39	667
QNQ38172.1	1.19e-171	40	682	39	667
QXQ95199.1	1.19e-171	40	682	39	667

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	1.52e-18	111	550	78	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	4.31e-16	322	550	381	608	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	5.27e-16	111	550	78	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000593	0.685979	0.312656	0.000285	0.000253	0.000222

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001376_03874.