CAZyme Information: MGYG000001376_04160

Basic Information

• Species: Dysgonomonas gadei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas gadei
• CAZyme ID: MGYG000001376_04160
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		44656.28	5.3255

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001376	5166013	Isolate	not provided	not provided

• Gene Location: Start: 18127; End: 19281 Strand: +

Full Sequence      

MKRKLYLLLPFFFIYASCIGNANKINESTSDNTMTETEVVELIKKVNNHWQSAHPGHENS
FWHRAAYHTGNMAAYETTGIEEYKAYSKAWSEKNEWKGAKSDDKQEWKYSYGETDEYVLF
GDFQTCFQVYIDLYNLDEEKDETKIARAKEVMKYQMSTPNVDYWWWADGLYMVMPVMTRL
YKITGDKQYLDKLYEYFAYARDLMYDKESSLFYRDAKYIYPKHKTNKGLKDFWARGNGWV
FAAIPRVLADLPQDNPHRAEYIQIYQDMAKAIAACQQEEGFWSRSMLDLEQAPGYETSGT
AFFAYGFLWGVNNNILDKDAYKPAIDKSWKYLTETALQPDGSIGYVQPIGERADQHKNVG
PDTTADFGVGAFLLAAAEMVKYLK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	54	380	1.2e-82	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.68e-94	43	383	2	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.75e-46	62	381	36	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
cd04792	LanM-like	7.60e-05	129	208	600	691	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK53693.1	1.32e-204	5	383	9	383
QIK59151.1	5.35e-204	5	383	9	383
QGT69617.1	5.96e-204	20	384	25	389
SCD19777.1	3.82e-199	1	384	1	386
QRX64606.1	4.08e-181	14	382	18	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	2.60e-171	29	384	23	376	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	7.98e-141	31	384	8	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	5.55e-55	50	381	39	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	6.64e-55	1	381	1	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	3.88e-53	50	381	44	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	4.34e-48	153	384	188	413	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000384	0.272415	0.726799	0.000135	0.000148	0.000117

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001376_04160.