CAZyme Information: MGYG000001377_00294

Basic Information

• Species: Dysgonomonas mossii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas mossii
• CAZyme ID: MGYG000001377_00294
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583		64808.26	9.4059

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001377	3951269	Isolate	not provided	not provided

• Gene Location: Start: 350688; End: 352439 Strand: -

Full Sequence      

MKLKHILFLSFILIACHSSLSYAYNTSISVTQTPKDEITTYTVAKGETVYSIAAAHNTSV
QQIYKLNPKAEQGIKAGDKLLLSKAKAVASYSNHLIEAKETLFSVSRLYKISVDDLKNAN
PGLTESTFSIGKTIRIPMFGGSSSTSNYAGQGTTRTNKEYKVQKKETLYSIGKANNVSVE
ALLDANPSLRTEGLRNGMTIIIPAGEATSKNNISQVNNTRKSEAPRATKGETVRVGILFP
FTDNSGSISKDKLAEYYEGFLLAVKDLKSKGLNAEIYTFDTGSEKNTKRLESLLETNEMK
NMHLIIGGVSKQQIDALVKFSKKTGIKYVIPFGSSSEITGIPLLFQMTSSHSSLYPEVTS
AFVKRFRNYNIIFVSEDGSNNDKMDFVNDLKKSLSKAGIQSKTITKSSNLGEDLKAAANA
TNNIIVPTSSSEATLRRITAVLNLSNDTPFSLFGYPEWQVYNSQVENLHKYDAYIYSIFF
LNEQQNAVQNFADDYKQWYNKNLINSFPKWGYLGYDTGLYFLTALKQYGSSFENNISNIN
VPTLQSCIYFEKVNDKNGGYVNNGIYFIHYKDNSSLEKIDITD

Enzyme Prediction     

No EC number prediction in MGYG000001377_00294.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	3.11e-10	39	82	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
PRK06347	PRK06347	9.68e-09	40	236	332	555	1,4-beta-N-acetylmuramoylhydrolase.
cd06268	PBP1_ABC_transporter_LIVBP-like	2.90e-08	234	516	1	281	periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type 1 periplasmic binding fold protein superfamily. Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type 1 periplasmic binding fold protein superfamily. They are mostly present in archaea and eubacteria, and are primarily involved in scavenging solutes from the environment. ABC-type transporters couple ATP hydrolysis with the uptake and efflux of a wide range of substrates across bacterial membranes, including amino acids, peptides, lipids and sterols, and various drugs. These systems are comprised of transmembrane domains, nucleotide binding domains, and in most bacterial uptake systems, periplasmic binding proteins (PBPs) which transfer the ligand to the extracellular gate of the transmembrane domains. These PBPs bind their substrates selectively and with high affinity. Members of this group include ABC-type Leucine-Isoleucine-Valine-Binding Proteins (LIVBP), which are homologous to the aliphatic amidase transcriptional repressor, AmiC, of Pseudomonas aeruginosa. The uncharacterized periplasmic components of various ABC-type transport systems are included in this group.
cd00118	LysM	4.85e-08	158	202	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	7.30e-08	41	82	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK53679.1	3.75e-135	41	580	48	594
QIK59137.1	7.47e-135	41	580	48	594
CEA14830.1	1.28e-124	41	580	125	670
SCD21596.1	3.56e-122	34	580	121	675
BBD45766.1	1.44e-120	32	580	106	660

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31852	5.21e-06	40	202	89	268	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000568	0.486038	0.512727	0.000244	0.000217	0.000183

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001377_00294.