CAZyme Information: MGYG000001377_00765

Basic Information

• Species: Dysgonomonas mossii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas mossii
• CAZyme ID: MGYG000001377_00765
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	MGYG000001377_2|CGC2	44926.46	5.4427

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001377	3951269	Isolate	not provided	not provided

• Gene Location: Start: 38543; End: 39727 Strand: +

Full Sequence      

MKQKYSLLFALVAILFTNCTDVDDVPALYPEYEEVKELSIVDKNATTETKALYSNLWAIQ
SKGFMFGHHDDLWYGRKWYNEEGRSDTKDVCGDYPAVFSFDVSEIMDDRYQNAANAIRRK
VAIEAYNRGEVLTASMHLNNPLTGGDSWDNSNKNVAKEILTEGSETNVKFKLWLDRLADF
ALNLKGSDGKNIPVIFRPFHEHTQGWSWWGSSCTTQEEFIALWKFTVNYLRDTKGVHNFI
YAISPQIDSVQGRDNFLFRWPGNDYVDFLGMDAYHGLNPNTFTSNLFTLSRLSKELKKPC
GVTETGVEGIQRGGVPEKNYWTQQILTPASGQFISLIVMWRNAYDPGESGKHFYSAFKGH
ASEKNFIKMYDSPVSFFSGDLPNMYQMAEGLTVN

Enzyme Prediction     

No EC number prediction in MGYG000001377_00765.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	41	371	4.1e-64	0.966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.64e-33	41	274	1	230	Glycosyl hydrolase family 26.
COG4124	ManB2	3.13e-17	121	348	117	346	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT72560.1	4.83e-246	1	393	1	393
QRM99613.1	4.83e-246	1	393	1	393
CBK67266.1	4.83e-246	1	393	1	393
QUT31668.1	1.96e-245	1	393	1	393
QUT88729.1	3.17e-185	1	394	1	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	7.15e-82	46	387	9	345	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX4_A	2.91e-70	39	386	32	396	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	4.10e-70	39	385	32	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	5.41e-70	39	386	55	419	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	2.27e-69	39	386	32	396	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	6.93e-48	3	386	14	416	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	1.55e-35	1	372	1	389	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	2.05e-14	126	306	120	294	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
G2Q4H7	6.25e-13	30	306	164	424	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	6.99e-11	42	274	148	377	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000012	1.000009	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001377_00765.