CAZyme Information: MGYG000001377_00793

Basic Information

• Species: Dysgonomonas mossii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas mossii
• CAZyme ID: MGYG000001377_00793
• CAZy Family: GH18
• CAZyme Description: Endo-beta-N-acetylglucosaminidase F2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327	MGYG000001377_2|CGC4	36823.63	4.8046

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001377	3951269	Isolate	not provided	not provided

• Gene Location: Start: 90615; End: 91598 Strand: +

Full Sequence      

MKTLSNILLICFLFFSLSSCLDEVDPENKIVGQVEPKSEEYYKQLRAYKESDHAVAFGWF
GGWNTETSSMGTRLVSIPDSVDIVSIWGKYWDITDAQKADLAYVQNVLGTKVTYTIFAHE
VPEPFEATTEGVGKYAKALADTMYKYNYDGLDLDYEPGFGGVGPLVGHNNALMKDFVLAL
SKYFGPKSGTGKLLLIDGVPYAVHPEIVECFNYGIVQAYDSSGEWDLQYRFNNALAKGWP
ADKYIFTEDFEKWWSTGGKPNAVVTTPDGEELVVPSLEAMARFNPKVDDKYQRKGGVGTY
HMENEYKHTPDYKYLRQAIQIMNPAKK

Enzyme Prediction     

No EC number prediction in MGYG000001377_00793.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16141	DUF4849	9.52e-59	40	321	23	318	Putative glycoside hydrolase Family 18, chitinase_18. This DUF is likely to be a form of glycosyl hydrolase from CAZy family 18, possibly chitinase 18. This would have the EC number of EC:3.2.1.14.
cd06542	GH18_EndoS-like	3.75e-51	55	314	2	250	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
pfam00704	Glyco_hydro_18	8.01e-05	124	260	81	212	Glycosyl hydrolases family 18.
cd06548	GH18_chitinase	2.60e-04	127	226	105	216	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
cd00598	GH18_chitinase-like	4.96e-04	57	220	2	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH55047.1	3.12e-118	19	325	20	320
QIU95223.1	4.17e-113	2	325	3	319
BBL06359.1	2.93e-105	17	325	18	329
QUB47181.1	2.55e-103	16	326	17	338
AFL77898.1	5.51e-103	1	325	1	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q64_A	4.82e-47	36	323	53	356	BT1044SeMetE190Q [Bacteroides thetaiotaomicron]
6KPL_A	6.33e-14	43	324	19	297	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in apo form [Cordyceps militaris CM01],6KPM_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in complex with L-fucose [Cordyceps militaris CM01]
6KPN_A	7.16e-13	43	324	19	297	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine [Cordyceps militaris CM01],6KPO_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine-Asn [Cordyceps militaris CM01]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36912	1.02e-15	45	324	52	335	Endo-beta-N-acetylglucosaminidase F2 OS=Elizabethkingia meningoseptica OX=238 GN=endOF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000170	0.102213	0.897493	0.000043	0.000059	0.000047

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001377_00793.