CAZyme Information: MGYG000001377_01130

Basic Information

• Species: Dysgonomonas mossii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas mossii
• CAZyme ID: MGYG000001377_01130
• CAZy Family: GH5
• CAZyme Description: Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
568	MGYG000001377_2|CGC11	62733.29	4.7553

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001377	3951269	Isolate	not provided	not provided

• Gene Location: Start: 459881; End: 461587 Strand: +

Full Sequence      

MKKYKFLLYTLICVCLTFFSISCSGDEDKNDPELIVSTDNLTFTKDGGDNTIHIKTNQRW
TVASSESWCTVSPASGEEIGTIKLIVSAQANTTTDIRNATLTITAGNIKKEVAVTQALTN
LLVVKKNIYDVKSEGENITVELQTSGSHEIVINGDWITKSSTKSVSDVSEVFVIAPNKNI
FEREGTIVFKVGNLSETVTIVQAATSLNIAADKTGMNNDAPALAAKMGLGWNLGNTLEAT
DGTTAGETTWGNPKASKALIDGVKAAGFNTVRIPCAWNAYIEDQTTYKISDARLARVKEV
VDYCIDNNMYAIINIHWDGGWLEENPTYDKQVEVNKKQKALWEQIAVYFRDYDEHLLFAG
TNEVHANYNTPSAENIEVQQSYNQTFINAVRSTGGKNTWRNLIVQSYNTNIDYAVNYMKM
PTDPTANRIMAEVHYYDPYDFTLAEENTIFLWGKDFSGAGVSTWGQEDWADTQFGKIKTN
FVDMGIPVILGEYAATLRASLSTADYANHVKARNYYLNYITKVAVQDGLIPVYWDNGPTG
DKASGLFNRTTGEQVHTDAINAIISAGK

Enzyme Prediction     

No EC number prediction in MGYG000001377_01130.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	247	537	3.9e-100	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	9.16e-53	247	538	16	270	Cellulase (glycosyl hydrolase family 5).
cd14948	BACON	6.49e-23	33	117	1	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
COG2730	BglC	4.39e-15	223	538	47	361	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam19190	BACON_2	3.84e-14	33	119	1	91	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.
cd14948	BACON	4.70e-13	122	203	2	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK55671.1	6.14e-194	1	568	1	490
QIK61079.1	2.01e-192	1	568	1	490
ADQ18612.1	3.76e-159	12	568	3	552
BAF57333.1	6.42e-154	218	566	22	372
ASB50110.1	5.66e-145	11	564	10	570

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OYC_A	1.68e-102	210	564	35	390	GH5endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYC_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107]
6HA9_A	1.32e-101	210	564	35	390	Structureof an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HA9_B Structure of an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_A Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_B Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107]
3ZMR_A	1.34e-101	26	564	2	463	Bacteroidesovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus],3ZMR_B Bacteroides ovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus]
2JEP_A	8.43e-77	219	564	34	391	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]
4W8A_A	5.38e-75	219	568	2	375	Crystalstructure of XEG5B, a GH5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in the native form [uncultured bacterium],4W8B_A Crystal structure of XEG5B, a GH5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in complex with XXLG [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXT7	3.37e-103	14	564	24	498	Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02653 PE=1 SV=1
O08342	2.70e-76	220	564	40	396	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P28621	7.55e-55	213	549	34	356	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P17901	8.56e-54	217	564	44	397	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1
P54937	1.47e-53	186	568	16	379	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000023	0.007835	0.992147	0.000004	0.000004	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001377_01130.