CAZyme Information: MGYG000001377_01175

Basic Information

• Species: Dysgonomonas mossii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas mossii
• CAZyme ID: MGYG000001377_01175
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
780		86110.3	7.087

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001377	3951269	Isolate	not provided	not provided

• Gene Location: Start: 518302; End: 520644 Strand: +

Full Sequence      

MNYLKLSIIALFLFQTISAQQAYKYKNPKLSSEERTVDLISHMTLEEKVGQLLCPLGWEM
YERNGNQVTHSKKFEEYVQQRHIGMLWATFRADPWTKKTLENGLNPKLAAKAGNALQRYI
MENTRLGIPIFLAEECPHGHMAIGTTVFPTAIGQAATWNPNLIQQMSAVISKEARSQGSH
IGYGPVLDLAREARWSRVEETYGEDPVLISKMGEAFVTGFGSGDLSKPYSLISTLKHFVA
YGIPDGGHNGNSNSVGMRDLKENYLPPFEKAVKAGALSVMTAYNSVDGIPCTSNEYLLKD
VLCKDWGFKGFTVSDLGSIEGLKGSHYVVSTIQEAAILSLTSGLDCDLGGNAFFTLSDAV
KKGMVGETQIDSAVYKILKLKFDMGLFENPYVDENNARQVVRTQENIVLARQVARESIVL
LENKNNVLPLNKSKIKKIAVIGPNADNVYNQLGDYTAPQDDSNVKTVLDGIRSKLKQSQI
EYVKGCAIRDTLNTDIDKAVQAALRSDVAVVVVGGSSARDFKTKYIETGAAVADEHSISD
MESGEGFDRVSLDLMGKQLELLKAIKATGKPVVVVYIQGRPLNMNWASENADALLSAWYP
GQEGGNAIADVLFGEYNPAGRLPMSVAKSVGQLPVYYNHRNPASHDYVEMTSKPLYSFGY
GLSFTSFEYSNLKINKSNSGVEVTVELRNSGNFDGDEVVQLYLRNNRASVVQPIMQLKAF
ERVNLKKGETKTIKLLLTKDDFSIIDKKMNRVVEPNGDFTFMVGSASDNIKLREKMMLNL

Enzyme Prediction     

No EC number prediction in MGYG000001377_01175.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	121	347	3.6e-65	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	771	1	758	beta-glucosidase BglX.
PLN03080	PLN03080	5.56e-91	22	764	39	769	Probable beta-xylosidase; Provisional
COG1472	BglX	1.09e-89	43	479	1	395	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.52e-71	44	380	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	6.33e-69	418	663	1	215	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK55799.1	0.0	24	774	22	771
QIK61194.1	0.0	24	774	22	771
QQS95806.1	0.0	5	776	3	775
QQT35466.1	0.0	5	776	3	775
QNL40717.1	0.0	19	776	23	780

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	1.79e-147	24	771	6	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.40e-146	24	771	6	749	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	2.46e-146	7	771	16	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	1.07e-135	121	778	65	733	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	5.15e-135	27	778	29	765	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	3.03e-143	83	771	7	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	1.84e-135	25	778	24	765	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	2.82e-134	25	771	24	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	2.00e-131	21	771	25	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
D5EY15	5.00e-94	18	767	17	849	Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyl3A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000215	0.999221	0.000146	0.000143	0.000128	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001377_01175.