CAZyme Information: MGYG000001377_01398

Basic Information

• Species: Dysgonomonas mossii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas mossii
• CAZyme ID: MGYG000001377_01398
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
263		30860.24	9.228

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001377	3951269	Isolate	not provided	not provided

• Gene Location: Start: 777046; End: 777837 Strand: -

Full Sequence      

MAKTVRKRTIRKRVNRRKSKKNNLKKYILSMSIAVCLGIAAFFVIKGFFEEPESFDSNKY
FVKGIDVSHHNPILNWDNVMEQDITFAYLKSTEGTTHEDRNYPFNYDLARKSNIKVGSYH
FYTFALSGEEQAKHFLKTAKFNSGDLIPAIDVEHSPANPYSKDKEFVGTVVKELKIMENK
LYEHFGVHPIIYTNRDCYKLYIKGNFTKNIIWMCDLHNEPSDDVNNWKIWQFSHKGELPG
VDGHVDLNYYRYTFNEFKELLLP

Enzyme Prediction     

No EC number prediction in MGYG000001377_01398.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	65	241	9.8e-43	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06413	GH25_muramidase_1	2.92e-57	60	248	1	187	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	1.02e-44	63	250	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06524	GH25_YegX-like	3.79e-44	63	251	1	193	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
COG3757	Acm	4.25e-40	49	251	50	254	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].
cd06525	GH25_Lyc-like	2.08e-32	63	250	1	184	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK61313.1	6.72e-106	32	263	16	252
QIK55915.1	2.72e-105	32	263	16	252
SCM58052.1	2.13e-92	57	263	45	251
BBD45620.1	1.28e-87	49	263	55	267
ADQ79379.1	1.52e-48	26	261	42	276

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	5.73e-37	58	258	12	214	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
1JFX_A	2.76e-18	62	248	5	200	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
5A6S_A	3.41e-07	90	249	50	200	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8FFY2	3.97e-25	60	258	65	262	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P76421	7.73e-25	60	258	65	262	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8X7H0	5.66e-24	60	258	65	262	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P25310	5.05e-17	62	248	82	277	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	1.24e-14	62	262	9	201	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999981	0.000032	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
27	49