CAZyme Information: MGYG000001377_01789

Basic Information

• Species: Dysgonomonas mossii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas mossii
• CAZyme ID: MGYG000001377_01789
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
770	MGYG000001377_3|CGC4	85514.39	5.7518

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001377	3951269	Isolate	not provided	not provided

• Gene Location: Start: 432239; End: 434551 Strand: -

Full Sequence      

MRKLAVLVVVLGIACGMYAQKGDAEKRAAEMVSKMTLAEKIGQMSQITVDLVCKGQDTPP
TSTLEIDADKVREAVVKYHVGSILNAPGTRARTPQWWTKAVEQIQEVATKETRMKIPVIY
GLDQIHGATYTAGSTMFPQEIGIAATWNPAHARKMGEITAYETRASNVPWNFSPVLDLGL
DPRFPRQYEGFGEDPYIGSVFGYELVKGYEGDDNNIANPTKVASCIKHFIGYSAPISGKD
RTPAYIPENVLLEYHVPAFKAAIDAGAHTIMINSGIINNVPVHASYELMTKLLREDLGFQ
GMIVTDWEDINKLYNRDKMVPSIKEAIKAGINAGIDMSMIPYNYKEFCDLLTELVNEGQV
PMSRIDDAATRVLTVKIKLGLFETPNTYAKDYPEFNSKAFQQASYNAAADGITLLKNNNN
VLPLTKSAKILVTGPNAVSRRALNGGWTFSWQGEKIDEFGDLYHNILDAVQQKFGKANVS
YVPGVSYTKETKWDTEHKDRFDEAIAAAKNVDYIILCLGENSYCEKPGDLNDLYLNDLQT
ELAQEMLKLGKKVILVLSEGRPRLISKFSSKVDGIVQTYLPGIYGADALADILAGDVNPS
GKLPYTYPAYPNSLVPYFHKYSDEQVNTDAAYNYEGDYNFEYPFGYGLSYTTFAYSNIKL
DKSQLPLHSNEEVTISVDIKNTGSRDGKEVVQLYTSDLVASLVPDVKRLRRFEKVALKAG
ETKTVTFKLKLNDLSFINLENKRVVEPGDFEFQVGSSSNDIKGKVLFTVK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	110	339	1.7e-67	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.86e-158	1	762	1	758	beta-glucosidase BglX.
COG1472	BglX	1.23e-85	35	448	1	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.33e-74	36	375	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	4.37e-63	27	755	52	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	4.21e-52	412	650	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIA99596.1	0.0	2	770	3	770
AFH08278.1	0.0	2	770	3	770
QIK56189.1	0.0	1	769	1	771
QIK61607.1	0.0	1	769	1	771
AIY68304.1	0.0	1	769	1	771

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	1.28e-241	25	761	14	746	Bacteroidesovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXL_A	6.54e-122	17	770	1	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.56e-121	17	770	1	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	4.23e-120	23	762	8	744	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	4.45e-112	23	758	2	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXU3	1.12e-240	25	761	36	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
Q23892	1.12e-165	31	756	83	813	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
Q56078	4.37e-120	30	762	40	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	3.33e-119	30	762	40	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	2.05e-115	99	770	49	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004494	0.621057	0.373535	0.000346	0.000269	0.000276

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001377_01789.