CAZyme Information: MGYG000001377_02287

Basic Information

• Species: Dysgonomonas mossii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas mossii
• CAZyme ID: MGYG000001377_02287
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
787	MGYG000001377_4|CGC9	89974.56	6.6583

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001377	3951269	Isolate	not provided	not provided

• Gene Location: Start: 259395; End: 261758 Strand: +

Full Sequence      

MKKLFTTIFSFICVIQLCAQETTPKIKYFDLKDITLLDSPFKRAQDLDKKYLLDLDADRL
LAPFIREAGLQKKAESYTNWENTGLDGHIGGHYVSALALMYASTGDQQIKDRLDYMISEL
KRCQDENGNGYIGGVPGGKAIWDEIAKGDIQASGFGLNNRWVPLYNIHKTYAGLRDAYLI
AGNETAKDMLIKMTDWAVKLVSNLSEEQIQDMLRSEHGGLNETFADVAVITQNEKYLKLA
HQFSHQLILNPLLAHEDKLTGLHANTQIPKVLGFKRIADIEGNESWSEASRFFWETVVEH
RSVCIGGNSVREHFHPTNDFSSMITSNEGPETCNTYNMLRLSKMFYQTSLDKKYIDYYEK
ALYNHILSSQNPQTGGLVYFTQMRPGHYRVYSQPQTSMWCCVGSGIESHAKYGEMIYAHT
SDALYVNLFIPSLLNWKDRNVEIVQDNKFPDESKTEITVNPKKKSEFTVYVRYPSWVEKG
TMKIKLNGKTYPGVEKDGYIGIKRTWQKGDRISVELPMTIVAEQLPDKSNYYSFRYGPIV
LAAKTGVEDMTGLFADDSRGGHIAHGTLLPLSEMPLLVSDKDDITSKIKPVPGKPLTFNL
SSLYSTEYPSELEFIPFFRLHESRYIIYLPQTTTEGLASLHEQIKRKEQERIKLDSKTID
KVACGEQQPESDHFIKFEESNAGSFENVHWREAKGWFSYQMRNRDKKAKILYVKYLASDK
LGMYEISINGEKLENLIMDRKTESGMQFILLDIPPSEMTKDILDIKFTANKEHTTPKIVE
VRLLEDK

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	34	542	2.1e-216	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	33	542	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	6.75e-117	31	618	9	571	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	9.44e-37	546	628	1	83	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK52968.1	0.0	1	787	1	786
SCD19719.1	0.0	2	784	4	785
QRX64622.1	0.0	2	786	5	788
AIM37032.1	0.0	1	787	3	789
CDT01493.1	0.0	12	784	15	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	3.25e-300	3	785	2	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.06e-288	3	785	2	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	7.31e-25	93	540	82	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.15e-22	93	540	82	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	7.43e-17	160	518	131	517	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000297	0.998818	0.000366	0.000179	0.000171	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001377_02287.