CAZyme Information: MGYG000001377_02608

Basic Information

• Species: Dysgonomonas mossii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas mossii
• CAZyme ID: MGYG000001377_02608
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535		62336.91	6.2988

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001377	3951269	Isolate	not provided	not provided

• Gene Location: Start: 259359; End: 260966 Strand: +

Full Sequence      

MKRLVSLIILSCIVTFNLFSQEKEEVPPKYNLPYKNTYVKEALVTENEYRIAKPEEVIPK
SFEEAKNILPSPIWEGHTKEIEMYWKAWQIAISNIRQPQKGSGFVSSYLDTAYNGNIFMW
DSSFMMMFARYGYRFFPFQHTLDNFYAKQHPDGFICREIKADGADCFERYDPTSTGPNLL
PWSEMLYYKQYGDNERLEKIFPALCAYYKWLKLNRTWPNGTYWSSGWGTGMDNMPRVQPQ
YNMIYSNGHMVWLDACLQQILMANVLLEIGFYLERWQEIEEFEDEIKMLTKYVHDNLWDE
KTGFLYDQYADGSLSTTMGIPAFWALHTDVLDAKQLDRMVKHLDDPKTFNRPHRVPSLSA
DNPKYNPRGRYWQGGVWPGTNYMVITGLEKKGYTKQAKEIAKNHYSNVFEVYKNTGTFWE
YYAPEAAEPGFMARKDFVGWTGLPPIAVFIEYILGIRSDYANHSVIWDITQTEAHGIERY
PYGPDGLVSFKVNKRNSADETPSVTIDSNVAFELTLLWGKDKSKKVSIQVGKQTI

Enzyme Prediction     

No EC number prediction in MGYG000001377_02608.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	86	440	8.5e-37	0.4052631578947368

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	1.04e-12	119	459	290	613	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PRK10137	PRK10137	2.03e-11	266	425	591	759	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	3.95e-11	197	443	188	487	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
pfam01204	Trehalase	0.002	297	441	349	497	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam17389	Bac_rhamnosid6H	0.010	179	343	105	251	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK56313.1	0.0	18	535	13	530
QIK61733.1	0.0	18	535	13	530
QPH58104.1	2.35e-308	29	534	29	533
QMI79244.1	1.92e-307	29	534	29	533
QQA30799.1	2.73e-307	29	534	29	533

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	1.02e-28	122	532	62	466	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
O14255	3.68e-16	197	443	528	799	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002011	0.774919	0.222317	0.000232	0.000252	0.000230

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001377_02608.