CAZyme Information: MGYG000001378_00176

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_00176
• CAZy Family: GH93
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
598	MGYG000001378_1|CGC6	66190.34	5.5258

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 253397; End: 255193 Strand: -

Full Sequence      

MKNTFFMLFFSIAISFIACGGSGENDENLLAGNGNTEKPKEDESQEPVVCSITPIGELNQ
GTPIINSHADVTKRSSLMMNYRMLVTMESSYPRYPRIKKMKNGDYILFYHNGSANNNIGR
RCVYALSKDLKTWSNKGEIFNSYDIIDSKGNKNIHCYANCDGLVLSNGDILAVASCRANS
GYRDLPEDAGIELKRSTDNGVTWSEPIKIYQGVNWEPFLLELPTGELHCYFTDSSRTGLE
GHGTDTGTAMVVSTDGGKTWKPDFSSSPYYVLRMRWEKNGIVGYNHQMPSVVRLNDNKGL
AAAVETNNSGYHISLCYSDKDKWEYLAADQEGPVDSNNCVFSGMGPYLGQLPSGETVLSY
ESSSKYTLKIGDATARNFGSAYQPFSGGYWGSFCIIDSHTLVGTNIKAKEGPVQMAQFVL
NHRIDAVKRKVTIDGNNKEWANTDHALFVGSKSQAQGTLRCSYDDDNIYFLLEVLDRNLL
ASDYASLYVSPVSNNKLSKGACCIQVTMNGLKNCEIYDASWKEAQLDAQVKTYVCNETNE
RLIDDYGYIAEIAIPRSKLTITSEQVLVNFSITKRNSLDAICDVASTSTARWIPVTGL

Enzyme Prediction     

No EC number prediction in MGYG000001378_00176.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	90	366	3e-24	0.8599348534201955

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	2.53e-13	163	260	20	125	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	3.49e-06	100	315	153	333	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd00241	DOMON_like	4.83e-05	450	566	13	134	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
pfam13088	BNR_2	1.46e-04	100	262	59	200	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	0.001	168	262	1	96	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBD46557.1	1.12e-06	171	332	172	344
QUT75110.1	2.10e-06	163	279	434	549

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000053	0.017765	0.982190	0.000008	0.000012	0.000009

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001378_00176.