CAZyme Information: MGYG000001378_00275

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_00275
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
528	MGYG000001378_1|CGC9	59860.09	5.3831

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 402946; End: 404532 Strand: -

Full Sequence      

MKGKKILAALGFFSIAGVAGGCSQPAPYIRYQIETDQPCQTMAYFSASDAWSMQFIGLWP
QEKQNQVADWLFSTENNANGQPKGIGLSLWRFNVGAGSTEQGENSQIASPWMRAECFLNS
DGTYDWNKQQGQRNFLKLAKERGVNKFLAFLNSPPVYYTQNGLATNTGRGGTANLKPDCY
EKYARFLADVVQGVEEHDGIKFNYICPFNEPDGHWNWVGPKQEGCPATNREVARTVRLLS
KEFVDRDMDTQILVNESSDYRCMFRTHETDWQRGYQIQAFFCPDSVDTYLGDTPNVPRLM
LGHSYWTTTPLSELRNIRCQLRDTLDKHQVGFWQTETCIMGNDEEIGGGNGFDHTMKTAL
YVARIIHHDIVYARAESWQWWRAIGGDYKDGLIREYTTDNNFLDGRVEDSKLMWALGNYS
RFIRPGAVRLSVSAFDQTGALIPDGDTDQQGLMCSAYKNVDGTYVMVVINYANEEKEFSI
DKEKVGNAQWQVYRTSDKEGENLLPVEKVKSGKTVQIPARSIITLQSY

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	30	525	9.6e-199	0.993801652892562

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	5.65e-142	33	393	6	366	O-Glycosyl hydrolase family 30.
COG5520	XynC	1.36e-10	1	470	1	395	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam17189	Glyco_hydro_30C	3.38e-07	426	525	1	63	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT72499.1	0.0	1	528	1	528
QUT79243.1	0.0	1	528	1	528
QDM10652.1	0.0	1	528	1	528
ALJ47685.1	0.0	1	527	4	530
QRQ59078.1	0.0	1	527	1	527

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	9.77e-88	40	525	17	494	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
7O0E_A	1.20e-12	60	528	35	448	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	1.31e-12	60	528	42	455	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6M5Z_A	7.99e-10	64	480	59	407	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
1NOF_A	2.64e-09	146	496	77	349	ChainA, xylanase [Dickeya chrysanthemi],2Y24_A Chain A, XYLANASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q76FP5	4.57e-17	45	272	38	268	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
G2Q1N4	1.29e-12	60	528	59	472	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000046	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001378_00275.