CAZyme Information: MGYG000001378_00282

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_00282
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000001378_1|CGC10	36469.15	8.8061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 416739; End: 417701 Strand: -

Full Sequence      

MLMLRKIVFFLFVFVGLSLFAQQDYMVSSYVRGNFYNRGRISTESLRASNDLIFLNVHPN
KDGSLSFENPRVFQGKGVTTWEGLIKSVRAKVKGTKVKIRLGASSGEWKAMVADEAARTT
FAKNIKTVLEKNKLDGIDLDFEWAENEKEYKDYSLAILKMREVLGDKYLFSVSLHPVCYK
ISKEAIEAVDFISLQCYGPSPVRFPIEKYCSDIQMVLEYGIPKEKLVAGVPFYGVTKDNS
KKTEAYFSFVQEGLITEPAQNEVIYKGEKYVFDGQDNIRTKTRYAMEQGLKGMMSWDLAT
DLPLDDSKSLLKAMVEELRK

Enzyme Prediction     

No EC number prediction in MGYG000001378_00282.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	50	308	1.7e-38	0.8918918918918919

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00636	Glyco_18	6.30e-32	52	301	29	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	6.23e-31	54	301	30	307	Glycosyl hydrolases family 18.
cd06548	GH18_chitinase	3.34e-27	36	301	11	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
cd02872	GH18_chitolectin_chitotriosidase	3.38e-18	82	301	55	341	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
cd00598	GH18_chitinase-like	3.36e-17	52	298	27	207	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT72505.1	1.29e-231	1	320	1	320
ALJ47692.1	1.01e-228	1	320	1	320
QRQ54595.1	1.01e-228	1	320	1	320
SCV07090.1	1.01e-228	1	320	1	320
QNL39890.1	2.56e-222	1	320	1	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XYZ_A	3.30e-17	52	301	39	290	Crystalstructure of the GH18 chitinase ChiB from the chitin utilization locus of Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]
6TSB_AAA	6.23e-11	26	301	37	337	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	6.64e-11	26	301	56	356	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
5XWQ_A	8.99e-10	52	320	25	370	Crystalstructure of chitinase (RmChi1) from Rhizomucor miehei (sp p32 2 1, MR) [Rhizomucor miehei],5YUQ_A Chain A, Chintase [Rhizomucor miehei],5YUQ_B Chain B, Chintase [Rhizomucor miehei],7FBT_A Chain A, Chitinase [Rhizomucor miehei]
4MNJ_A	3.51e-09	80	302	54	334	CrystalStructure of GH18 Chitinase from Cycad, Cycas revoluta [Cycas revoluta],4MNK_A Crystal Structure of GH18 Chitinase from Cycas revoluta in complex with (GlcNAc)3 [Cycas revoluta],4R5E_A Chain A, Chitinase A [Cycas revoluta]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9W092	2.32e-12	96	301	119	389	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
P20533	2.28e-07	62	301	113	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
C5P230	3.16e-07	105	301	134	383	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
P0CB51	3.16e-07	105	301	134	383	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
Q1E3R8	3.16e-07	105	301	134	383	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000858	0.998226	0.000365	0.000174	0.000177	0.000186

TMHMM  Annotations     

start	end
7	26