CAZyme Information: MGYG000001378_00512

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_00512
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547	MGYG000001378_1|CGC18	60647.69	4.596

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 782665; End: 784308 Strand: +

Full Sequence      

MKNNPFKYFVFLMLSLLMVATTGCTEDDISMPAGQLPDETPMNSVGGQLCSGKTFSNKIT
VSMYEGDGAVTEEICYALTKPAITAVTVKAIPSPELVAQYNSDNETDMKEFPVANVTLGN
GGSLTVAAGKKESGTISITLSPDGLKPETLYLLAIALTQNPVGVDAQGNKQVIYYRVNFR
EKTITCIPGTTGQIQDIPPLLPEVITVFYVNTETYQPLIASAWGIMLDDMITRPYPIYSL
GNIVNLKRATIGYDGVSQRALFELGSDLAYVLEHRDKYIRHLQEYKRKVCLCIENGGKGI
GFCNMNDTQIADFVRQVKDVIERYQLDGVNLWDEDGKYGKAEMPGMNTTSYPRLIKALRE
ALPDKLLTLVDKGDATEYFYDVSRCGGIEVGGYIDYAWHGYFSSTEELQIINPNLDGSVQ
TYSKYTRRSIAGLTETRYGCVNVPRYSSNDPNIRNRAADIICKWKSGGNKKSNILIYGDD
LIGNEYGDRENAARIMLGDYSLLQFMDDGDGWDFSRDELIWGDVVYSGVSLDPGVEHAAG
NTYRKDW

Enzyme Prediction     

No EC number prediction in MGYG000001378_00512.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	222	403	7.3e-16	0.4560810810810811

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06542	GH18_EndoS-like	4.75e-19	270	404	48	178	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
pfam08522	DUF1735	1.53e-11	56	158	13	114	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.
pfam00704	Glyco_hydro_18	6.31e-07	279	398	56	171	Glycosyl hydrolases family 18.
cd00598	GH18_chitinase-like	1.78e-05	242	396	25	170	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
cd02871	GH18_chitinase_D-like	0.002	279	412	66	179	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT72701.1	0.0	1	547	1	547
ALJ47937.1	2.63e-311	1	547	1	546
SCV07341.1	2.63e-311	1	547	1	546
QRQ54816.1	2.63e-311	1	547	1	546
BCA50676.1	2.56e-273	3	547	2	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1C8X_A	3.65e-20	249	433	41	224	ChainA, ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H [Streptomyces plicatus]
1C8Y_A	3.65e-20	249	433	41	224	ChainA, ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H [Streptomyces plicatus]
1C3F_A	4.94e-20	249	433	41	224	ChainA, ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H [Streptomyces plicatus]
1EDT_A	5.51e-20	249	433	46	229	ChainA, ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H, ENDO H [Streptomyces plicatus]
6VE1_A	6.55e-20	249	433	50	233	ChainA, Endo-beta-N-acetylglucosaminidase H [Streptomyces plicatus],6VE1_B Chain B, Endo-beta-N-acetylglucosaminidase H [Streptomyces plicatus],6VE1_C Chain C, Endo-beta-N-acetylglucosaminidase H [Streptomyces plicatus],6VE1_D Chain D, Endo-beta-N-acetylglucosaminidase H [Streptomyces plicatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P04067	5.95e-19	249	433	88	271	Endo-beta-N-acetylglucosaminidase H OS=Streptomyces plicatus OX=1922 PE=1 SV=1
P80036	2.90e-13	249	418	91	253	Endo-beta-N-acetylglucosaminidase OS=Flavobacterium sp. (strain SK1022) OX=148444 PE=1 SV=2
P36911	1.19e-12	240	482	88	329	Endo-beta-N-acetylglucosaminidase F1 OS=Elizabethkingia meningoseptica OX=238 GN=endOF1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000828	0.999218	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001378_00512.