CAZyme Information: MGYG000001378_00567

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_00567
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258	MGYG000001378_1|CGC19	28990.49	7.798

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 846742; End: 847518 Strand: +

Full Sequence      

MMKQWTTLLVFLFLSLSLSAQQEYGRDIFVSSKGDSLPYRMIHPESVKPGEKYPLVLFLH
GAGERGNDNEKQLTHGGQMFLNPVNQEKYPAFVLIPQCPTDGYWAYTGRPKSLIPTEMPV
GQEISPILQTLKQLLDSYLVMPEVDTQRVYIIGLSMGAMGTYDLVVRYPEIFAAAVPICG
TVNPSRLSVAKDVKFRIFHGDADDVVPVKGSREAYKALKAAGADVEYIEFPGCNHGSWNP
AFNYPGFMDWLFKQKKKR

Enzyme Prediction     

No EC number prediction in MGYG000001378_00567.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	34	237	1.3e-26	0.8942731277533039

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	1.04e-49	32	255	169	386	Predicted peptidase [General function prediction only].
COG1506	DAP2	3.50e-19	29	258	370	620	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG0400	YpfH	1.50e-16	41	232	5	186	Predicted esterase [General function prediction only].
pfam02230	Abhydrolase_2	5.71e-12	43	239	3	203	Phospholipase/Carboxylesterase. This family consists of both phospholipases and carboxylesterases with broad substrate specificity, and is structurally related to alpha/beta hydrolases pfam00561.
COG3509	LpqC	5.63e-11	32	210	42	208	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61582.1	3.36e-51	37	255	825	1042
ABS60377.1	2.73e-49	37	257	22	246
QDU56037.1	3.97e-32	51	256	817	1007
VTR91196.1	2.73e-31	22	256	31	239
QJW99051.1	1.31e-30	37	256	44	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	1.25e-51	34	256	155	380	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	1.62e-28	33	258	17	219	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
4Q82_A	5.41e-12	51	256	78	277	CrystalStructure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365],4Q82_B Crystal Structure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365]
5DWD_A	8.81e-06	50	235	38	222	Crystalstructure of esterase PE8 [Pelagibacterium halotolerans B2],5DWD_B Crystal structure of esterase PE8 [Pelagibacterium halotolerans B2]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000290	0.999068	0.000185	0.000149	0.000143	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001378_00567.