CAZyme Information: MGYG000001378_01719

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_01719
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		40022.13	9.0044

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 217008; End: 218015 Strand: -

Full Sequence      

MLNENTDYFKYVDNLAKTAHIASVPIFESKLDFIPEITIAIPTYKRTDLLKEALDSALNQ
INFDNYEVIVVDNNPEREDETEKFMVSYKLNKRVSYYKNEVNLGMFGNWNRCFYLSKTKW
VTLLHDDDLYSNNYLSVAYYLLSKTNAEGINIGHYFWKEKEYPFANIKRTEIPPKIPCKN
ISVYDMLLGPHIGPTGYFFLRDNLIKLGGFNEDYFPIADYIFYSKYVYYYSVYYCPLKLG
IYRIRVNESLKFETIDKIHYYSYLFRLYLSEKTFCPSLYRSISNVIFKKNYKREIIDKKY
GGAQYLTIYRQINYGIISLILRKLHECYFKLKRNL

Enzyme Prediction     

No EC number prediction in MGYG000001378_01719.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	38	200	5.9e-24	0.9470588235294117

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	2.36e-18	38	201	1	159	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	5.15e-14	39	142	1	102	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	4.76e-11	38	222	1	172	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
PRK10018	PRK10018	8.56e-11	35	137	5	105	colanic acid biosynthesis glycosyltransferase WcaA.
COG0463	WcaA	1.91e-10	35	333	3	291	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT71094.1	6.30e-251	1	335	1	335
QUT82547.1	3.74e-56	1	255	1	250
QDM12130.1	3.74e-56	1	255	1	250
ADO82602.1	2.89e-54	4	260	4	269
AVQ28642.1	2.73e-51	7	295	4	302

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1RIM7	2.57e-07	33	214	11	194	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1
Q4UM29	5.73e-07	33	225	12	200	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001378_01719.