CAZyme Information: MGYG000001378_02216

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_02216
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469	MGYG000001378_4|CGC1	52892.19	6.2377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 24399; End: 25808 Strand: +

Full Sequence      

MNVRVITIALLLATLPVGAQKKKTVVNDSNTPLHLLQPAYQGTYGDLSPEQVKKDIDRVF
AYIDKETPARVVDKNTGKLITDYTTMGEEAQLERGAFRLASYEWGVTYSALIAAAEATGD
QRYMDYVQNRFRFLAEVAPHFKRVYEEKGTTDPQLLQILTPHALDDAGAVCAAMVKVRVK
DRSLPVDGLIENYFDFIQNKEYRLADGTFARNRPQHNTLWLDDMFMGIPAVAQMSRYDKA
QKEIYLAEAVRQFLQFADRMFIPEKGLYRHGWVESSTDHPAFCWARANGWAMLTACELLD
VLPEDYPQRAKVMDYFRAHVRGVTALQSGEGLWHQLLDRNDSYLETSATAIYVYCLAHAI
NKGWIDAIAYGPVAHLGWHAVAGKINAEGQVEGTCVGTGMAFDPAFYYYRPVNVYAAHGY
GPVLWAGAEMISLLKNQYPQMNDSAVQYYQVKQKTTAPIFAIDTEEKKD

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	96	431	5.2e-91	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.24e-105	62	434	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.53e-48	102	434	36	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT73562.1	0.0	1	469	1	469
QUT83152.1	0.0	1	469	1	469
QDM11721.1	0.0	1	469	1	469
QNL41146.1	0.0	1	469	1	469
ALJ49015.1	0.0	1	469	1	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	1.84e-304	22	465	2	445	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	4.09e-22	216	413	163	360	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	9.28e-20	216	413	164	361	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
1NC5_A	1.14e-19	102	436	41	370	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.61e-19	102	436	31	360	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	6.27e-19	102	436	41	370	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	1.71e-17	220	431	201	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	7.43e-17	101	438	28	343	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000514	0.997372	0.001541	0.000184	0.000182	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001378_02216.