CAZyme Information: MGYG000001378_02666

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_02666
• CAZy Family: GH99
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
597		68932.73	7.9472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 88876; End: 90669 Strand: -

Full Sequence      

MRKLLLFLLVSIALPALAQNGKKVYADFHGVRYTRQHDGKLGRWEMYANTEKSSTGRKSL
CYNADLIDSEGRHEIAAVAYPQVGMQSNLDPDYIEYQILSAKAAKIDGFFIEWGFKPHEN
DILLREMQKVAAKYDFEIGVNWCDGWLYYDWITKIYPEVNTREAKTEYMAKCYQYLVDSV
FTGPTAPMVKGMPVFYHFGPGAKVDEYKKVLSQVKFPQGMRQLVALRRWADWGKLENDKY
IPVTRSDEMDTWKEVGEIPTAWLPARVRTRDQAHAEWDNYATQDDVIEFMKPFRDSIWHS
NNPAYTIKSGFAMPGMDNRGCAGWGRGHFYYIPRNNGETYQSMWKFCMAEKDSLDMMFIA
SWSDYTEGHEIEPTIENGDRELHTTLKYAAEFKDEQADERGLTLPLMLFRLRKEARFLEK
TKMDVSGCQRSLDKAALLISQGRYPVAIGLLSQIENDVKTAKSALAVEMMRLRESDMKIQ
GKRKSGGYSAEETLSISLPKELVSKLQMNNYVGYLYFEYLDKGNESLFIRSSTQREPKEP
FKIVSRIRTDNTGEWKSAKVELYKDNIVNGFNMPTFYLKGNVVVRNLSLGYTIYTVK

Enzyme Prediction     

No EC number prediction in MGYG000001378_02666.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH99	36	378	7.2e-22	0.8862275449101796

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11575	GH99_GH71_like_3	5.30e-149	19	447	4	376	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.
cd11573	GH99_GH71_like	7.89e-16	90	382	9	262	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.
cd11574	GH99	2.83e-04	332	391	268	324	Glycoside hydrolase family 99, an endo-alpha-1,2-mannosidase. This family of glycoside hydrolases 99 (following the CAZY nomenclature) includes endo-alpha-1,2-mannosidase (EC 3.2.1.130), which is an important membrane-associated eukaryotic enzyme involved in the maturation of N-linked glycans. Specifically, it cleaves mannoside linkages internal to N-linked glycan chains by hydrolyzing an alpha-1,2-mannosidic bond between a glucose-substituted mannose and the remainder of the chain. The biological function and significance of the soluble bacterial orthologs, which may have obtained the genes via horizontal transfer, is not clear.
cd11577	GH71	0.006	324	393	199	265	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT51249.1	1.06e-113	20	468	151	603
AYN68372.1	1.59e-16	19	414	77	414
BBO35825.1	3.24e-15	63	413	72	372
QEG36695.1	6.67e-15	63	414	277	572
QDV73953.1	9.25e-14	63	414	65	367

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000228	0.999138	0.000168	0.000148	0.000152	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001378_02666.