CAZyme Information: MGYG000001378_02696

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_02696
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
546	MGYG000001378_5|CGC2	59437.88	5.7452

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 138930; End: 140570 Strand: +

Full Sequence      

MKNNKVKFIFVALLFATQVESFSSCSTSSVNEDNKEQETPPDSPSVSPPVEETAYAFPGA
EGGGMNTTGGRGGKVYIVRSLEDSKAPGTLRYAIEQKEPRIIVFCISGTIYLKSTLDIRN
GDVTIAGQTAPGDGICLAHFPVNVSADNVILRYLRFRMGDTDLLGSSASDGADALGGRQK
NNIMIDHCSISWSTDECASFYDNTNFTMQWCIISESLRLSGHTKGPHGYGGIWGGVNASY
HHNLMAHHDSRTPRFGSGVKYQGQERTDMRNNVIYNWSGNGCYGGAAMGINIVDNYYKPG
PATDAKVANRVMAIDISSSDGDFAPIKGVLGQYHISRNYFEAGNQLTEASAAKVNKDNWT
GIRNNTGHSLDELKRDTSVEVDAVTTHTAQKAYELVLKYAGCSLKRDDIDTRIVEETRTG
TAQFIGKNEHNGLGDAPCPNGPCEHCDKGIIHWKSQNYPKGGLIDSQKDLKPSGAGSDWS
AWPTLKSLTQITDSDNDGMPDEWETANGLNPNKYDANGRNLSTAYDNIEVYINSLVETIT
NTQNKK

Enzyme Prediction     

No EC number prediction in MGYG000001378_02696.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	107	297	3.7e-80	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00656	Amb_all	1.46e-05	109	292	3	179	Amb_all domain.
COG3866	PelB	8.13e-05	67	257	48	240	Pectate lyase [Carbohydrate transport and metabolism].
pfam18884	TSP3_bac	0.008	493	513	1	21	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT73184.1	0.0	1	546	1	546
QDM11318.1	0.0	1	546	1	546
QUT78469.1	0.0	1	546	1	546
SCV07874.1	0.0	1	546	1	546
QRQ55302.1	0.0	1	546	1	546

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	4.29e-46	56	536	22	414	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
B0XMA2	6.07e-46	56	536	23	415	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	1.17e-45	56	536	23	415	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
Q2UB83	2.96e-44	56	536	22	414	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
A1DPF0	4.19e-44	56	536	23	415	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000809	0.357339	0.641463	0.000128	0.000126	0.000121

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001378_02696.