CAZyme Information: MGYG000001378_02978

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_02978
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527	MGYG000001378_6|CGC2	57394.15	4.9885

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 97566; End: 99149 Strand: +

Full Sequence      

MLKSIKMGLLCFCVINLSVACSSEDPSITDETPGQNTGNGGNENEGGEEETPAETRYAFP
GAYGAGRYTTGGAGGDVYIVTSLEDNDKTTQGTLRYALNRTGKRTIVFAVSGLIELKSPL
RITNGDVTIAGQSAPGDGICLKGHPVSVQADNVIIRFMRFRMGSDNFTTEAEADSGDALW
GKQHKNIIIDHCSMSWSTDECASFYDNTNFTMQWCIISESLNRSVHTKGNHGYGGIWGGS
PATFHHNLLAHHSSRTPRLCGSRYTGKPENEKLDLRNNVFYNWGPTNGGYAGEGGSYNFV
NNYYKPGPVTNTKKNIVNRIFQPNGDDGTNKNTKSIWGTFYLKGNYFDGTCPELKAEYQS
LLTSVNNDNWQGLHPNATEAVPLPDGGEKALQSSNEFTISEDASEFTQSAKEAYESVLKY
AGASLKYDDVDKRIIANVRNGDYTADGSNGSEKGLIDKASDVGGWPEYKKETGPKDTDGD
GIPDEWETANGLNPKSKADGSKYTLSKTYTNLEVYLNSLVETLYPNK

Enzyme Prediction     

EC	4.2.2.2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	111	304	1.2e-80	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00656	Amb_all	4.57e-08	122	296	13	175	Amb_all domain.
COG3866	PelB	8.02e-07	69	313	48	286	Pectate lyase [Carbohydrate transport and metabolism].
pfam18884	TSP3_bac	0.009	476	494	1	19	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT73503.1	0.0	1	527	1	527
QUT78076.1	0.0	1	527	1	527
QDM11673.1	0.0	1	527	1	527
QRQ55767.1	0.0	1	527	1	527
SCV08375.1	0.0	1	527	1	527

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PXZ_A	2.97e-09	62	199	25	173	ChainA, Major pollen allergen Jun a 1 [Juniperus ashei],1PXZ_B Chain B, Major pollen allergen Jun a 1 [Juniperus ashei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4WL88	2.22e-51	58	524	23	419	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B0XMA2	3.09e-51	58	524	23	419	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
A1DPF0	3.16e-48	58	524	23	419	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
Q5B297	4.49e-48	58	526	22	417	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1
B8NQQ7	4.28e-47	58	524	22	418	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000062	0.999972	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001378_02978.