CAZyme Information: MGYG000001378_02984

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_02984
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314	MGYG000001378_6|CGC2	35477.08	7.6273

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 109327; End: 110271 Strand: -

Full Sequence      

MCLLLLGVGATSVYAQQQQRKDTLVVARDGTGEYRNIQEAVEAVRAFMDYTVTIYIKNGI
YKEKLVIPSWVKNVQLVGESAEKTIITYDDHANINKMGTFRTYTVKVEGNDITFKDLTIE
NNAAPLGQAVALHTEGDRLMFVNCRFLGNQDTIYTGTEGARLLFTNCYIEGTTDFIFGPS
TALFEYCELHSKRDSYITAASTPQSEEFGYVFKNCKLTAAPGVKKVYLGRPWRPYAATVF
INCEFGNHIRPEGWHNWRNPENEKTARYAEFGNTGAGADTSGRVAWAKQLTNKEAMKYTP
QNIFKESSNWYPYK

Enzyme Prediction     

No EC number prediction in MGYG000001378_02984.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	24	305	2.1e-107	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	3.62e-84	25	302	3	293	Pectinesterase.
PLN02773	PLN02773	2.00e-83	18	295	1	287	pectinesterase
PLN02432	PLN02432	1.60e-76	24	295	13	277	putative pectinesterase
PLN02682	PLN02682	2.39e-70	23	295	70	352	pectinesterase family protein
PLN02708	PLN02708	2.10e-69	26	312	245	550	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ48951.1	2.51e-219	1	314	10	323
QGT73499.1	2.51e-219	1	314	10	323
QRQ55762.1	2.51e-219	1	314	10	323
SCV08370.1	2.51e-219	1	314	10	323
QUT27344.1	5.15e-219	1	314	1	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	2.77e-39	24	300	9	298	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	5.76e-37	25	310	6	303	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	3.59e-30	24	283	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.88e-29	24	283	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NTB_A	8.93e-23	34	312	18	339	Crystalstructure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTB_B Crystal structure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTP_A Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTP_B Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTQ_A Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937],2NTQ_B Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.14e-50	26	295	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	1.31e-48	21	310	270	572	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q42608	2.11e-46	21	310	257	559	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
O49298	2.30e-46	21	310	248	542	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
Q9LXD9	4.26e-46	21	310	238	546	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000655	0.998585	0.000184	0.000209	0.000176	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001378_02984.