CAZyme Information: MGYG000001378_03483

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_03483
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782	MGYG000001378_7|CGC11	87598.78	7.2654

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 307626; End: 309974 Strand: -

Full Sequence      

MIGYIFCLPWQLFHVPYSTVVTDRNEELLGARIASDGQWRFPPRKTTPEKIKQCLITFED
KHFYHHWGVNPLSTGRALYQNLKNKRVVSGGSTLTMQTIRLARNKPRTIGEKVIEMIWAT
RLEFRTSKEEILSMYVSHAPFGGNVVGLDAAAWRYFGHSAEDLSWAESAMLAVLPNAPAM
IHLSKGRKTLLSKRNRLLKQLFEEEIIDASTYELAISEPLPDEPHPLPQIAPHLVTRFYQ
ERNGLYTRSTIDKGIQTHIESLAERWSNEFNRSDIRNLAILIIDIPTNQVVAYCGNVHFD
RKQGGNQVDVIQAPRSTGSILKPFLYGAMLQEGSLLPQMLLPDVPVNINGFTPQNFSLQF
EGAVPASEALARSLNIPAVTMLQRYGVPKFHHMLQQMGFKTINRSASHYGLSLILGGAEA
TLWDVTNAYAQMGRSLSNSHSNDLPQEKEVQILLGTEEKTVSERDGSRKVTSGKIISRKT
TSRKDISEGVISEGVISAGAAWLTLSALTEVNRPEEIDWKSIPSMQTIAWKTGTSYGFRD
AWAVGVTPRYAVGVWVGNATGEGKPGLVGAQTAGPVLFDIFNYLPSSPWFERPTGIFVDA
EICRQSGHLKGRFCEETDTVLILPVGLRTEACPYHHLVTLSADESHRIYENCANTEPTIQ
KSWFALPPVWEWYYKQHHPEYKPLPPFKAGCGEDSFQPMQFIYPPMNAHIKLPKQLDGSK
GFITVELAHSNPNATIFWHLDDTYQTQTQDFHKISLQPAPGKHSLTAVDGEGNTVSTTFF
IE

Enzyme Prediction     

No EC number prediction in MGYG000001378_03483.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	44	201	6.2e-46	0.8926553672316384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02073	PBP_1c	0.0	12	782	5	727	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	0.0	14	782	32	732	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
PRK11240	PRK11240	4.12e-123	35	607	57	592	penicillin-binding protein 1C; Provisional
COG0744	MrcB	4.61e-101	15	601	52	613	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	1.88e-97	48	583	11	527	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT69514.1	0.0	1	782	26	807
QDM08494.1	0.0	1	782	26	807
SCV09063.1	0.0	1	782	26	807
QUT82422.1	0.0	1	782	1	782
QRQ56408.1	0.0	1	782	26	807

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FGZ_A	3.32e-31	41	429	158	568	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	3.55e-31	41	429	179	589	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3FWL_A	7.09e-29	41	429	162	572	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]
2OQO_A	1.08e-28	48	218	29	200	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	3.70e-28	48	218	29	200	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	2.84e-96	9	586	33	566	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
Q9KUC0	7.62e-39	35	610	176	741	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
P40750	9.13e-36	23	560	60	599	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
Q89AR2	6.26e-34	25	558	142	667	Penicillin-binding protein 1B OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) OX=224915 GN=mrcB PE=3 SV=1
P45345	9.74e-34	15	582	143	702	Penicillin-binding protein 1B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.990630	0.008890	0.000423	0.000030	0.000015	0.000043

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001378_03483.